DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5347 and Mkrn1

Sequence 1:NP_572970.1 Gene:CG5347 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001246867.1 Gene:Mkrn1 FlyBaseID:FBgn0029152 Length:386 Species:Drosophila melanogaster

Alignment Length:313 Identity:178/314 (57%)
Similarity:215/314 (68%) Gaps:49/314 (16%)


  Fly     1 MSYRRSQTICRFHLLGICRFGDLCRFSHDETTPNDNQSPQISE-IADEVVENEQVVAST------ 58
            |:..|||||||:::.||||||:|||||||.:    ...|:..| :|.:|:......:|:      
  Fly    14 MALGRSQTICRYYVRGICRFGELCRFSHDLS----RGRPECEEQVATDVLPKPSTSSSSTIGSRS 74

  Fly    59 -SSYSRQMTWANAPEFVP---RYKAN-SADFQAT---EGVQD---------ICP----------- 95
             |..|:|..|||||.|||   ||.|: .::|:.|   |.|.:         :.|           
  Fly    75 ASISSQQRNWANAPVFVPSQKRYTAHEQSEFETTVDPEAVMEAQAGASYDTLAPGVSWAEVVGGP 139

  Fly    96 -------YG---GSCIWGSKCSYPLHMEICKMCDLYCLHPMDQNQRRAHNRECLEQHEQAMELSF 150
                   ||   .||.||...:||:|||:|:|||.|||||.||.|||:||||||:||||||||||
  Fly   140 SSLNKEDYGEENSSCAWGEFSAYPIHMELCEMCDQYCLHPTDQVQRRSHNRECLQQHEQAMELSF 204

  Fly   151 AIARSKDKMCGICFDTVVEKKGRERRFGILSKCKHIFCLTCIRTWRQAHQFEATVTRGCPECRVF 215
            ||||||||.|||||||::||.|||:|||||..|.|||||.||||||||.|||..:||.||||||.
  Fly   205 AIARSKDKTCGICFDTIMEKAGREKRFGILPNCNHIFCLECIRTWRQAKQFENKITRACPECRVC 269

  Fly   216 SEFVCPSAYWVDTKEEKDKLLSEYRAAMGAKDCKYFNGGLGKCPFGNKCFYRH 268
            |:||||||:|::|||||||||::||||:||||||||..|.|||||||||||:|
  Fly   270 SDFVCPSAFWMETKEEKDKLLNDYRAALGAKDCKYFKKGEGKCPFGNKCFYKH 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 20/26 (77%)
PHA03096 <80..239 CDD:222981 113/193 (59%)
RING 159..213 CDD:238093 40/54 (74%)
Mkrn1NP_001246867.1 ZnF_C3H1 20..43 CDD:214632 18/23 (78%)
RING 213..267 CDD:238093 40/54 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47134773
eggNOG 1 0.900 E1_KOG1039
Homologene 1 1.000 H32175
Inparanoid 1 1.050 171 1.000 Inparanoid score I1488
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1388677at2759
OrthoFinder 1 1.000 FOG0000573
orthoMCL 1 0.900 OOG5_129951
Panther 1 1.100 P PTHR11224
RoundUp 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.