DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5347 and Mkrn1

Sequence 1:NP_572970.1 Gene:CG5347 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:XP_006236363.1 Gene:Mkrn1 RGDID:1303251 Length:481 Species:Rattus norvegicus

Alignment Length:353 Identity:135/354 (38%)
Similarity:170/354 (48%) Gaps:76/354 (21%)


  Fly     7 QTICRFHLLGICRFGDLCRFSHD-----------------------------------ETTPND- 35
            |..||:.:.|:|:.||.||:|||                                   |.|..| 
  Rat    58 QVTCRYFMHGVCKEGDNCRYSHDLSDSPYGVVCKYFQRGYCVYGDRCRYEHSKPLKQEEVTATDL 122

  Fly    36 --NQSPQISEIADEVVENEQVVASTSSYSRQMT----------WANAPEFVP--RYKANSA---- 82
              ..||..|......|.:...:....:.||...          |.||.||||  .|...:|    
  Rat   123 SAKPSPAASSSLPSGVGSLAEMNPGEAESRNPNFPTVGAGSEDWVNAIEFVPGQPYCGRTAPSCT 187

  Fly    83 ---------------DFQATEGVQDICPYG--GSCIWGSKCSYPLHMEICKMCDLYCLHPMDQNQ 130
                           :....|..:.:|||.  |.|.:|..|.| ||.:.|.||.|..|||||..|
  Rat   188 EVPLQGSVTKEESEKEPTTVETEKQLCPYAAVGECRYGENCVY-LHGDSCDMCGLQVLHPMDAAQ 251

  Fly   131 RRAHNRECLEQHEQAMELSFAIARSKDKMCGICFDTVVEKKG-RERRFGILSKCKHIFCLTCIRT 194
            |..|.:.|:|.||:.||||||:.||||.:||||.:.|.||.. .||||||||.|.|.:||.|||.
  Rat   252 RSQHIKSCIEAHEKDMELSFAVQRSKDMVCGICMEVVYEKANPSERRFGILSNCNHTYCLKCIRK 316

  Fly   195 WRQAHQFEATVTRGCPECRVFSEFVCPSAYWVDTKEEKDKLLSEYRAAMGAKDCKYFNGGLGKCP 259
            ||.|.|||:.:.:.|||||:.|.||.||.|||:.||||.||:.:|:.||..|.|:||:.|.|.||
  Rat   317 WRSAKQFESKIIKSCPECRITSNFVIPSEYWVEEKEEKQKLIQKYKEAMSNKACRYFDEGRGSCP 381

  Fly   260 FGNKCFYRH---HRRCDDNQTQSNAVNS 284
            ||..|||:|   ..|.::.|.|....:|
  Rat   382 FGGNCFYKHAYPDGRREEPQRQKVGTSS 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 12/58 (21%)
PHA03096 <80..239 CDD:222981 85/181 (47%)
RING 159..213 CDD:238093 32/55 (58%)
Mkrn1XP_006236363.1 ZnF_C3H1 55..81 CDD:214632 12/23 (52%)
ZnF_C3H1 88..110 CDD:214632 0/22 (0%)
PHA03096 <221..370 CDD:222981 83/150 (55%)
RING 281..335 CDD:238093 32/54 (59%)
MKRN1_C 400..479 CDD:292443 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1039
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1388677at2759
OrthoFinder 1 1.000 FOG0000573
OrthoInspector 1 1.000 T131289
orthoMCL 1 0.900 OOG5_129951
Panther 1 1.100 O PTHR11224
Phylome 1 0.910 0.889 Consistency score
TreeFam 1 0.960
98.780

Return to query results.
Submit another query.