DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5347 and Mkrn3

Sequence 1:NP_572970.1 Gene:CG5347 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:XP_218735.6 Gene:Mkrn3 RGDID:1311197 Length:529 Species:Rattus norvegicus

Alignment Length:347 Identity:129/348 (37%)
Similarity:171/348 (49%) Gaps:86/348 (25%)


  Fly     7 QTICRFHLLGICRFGDLCRFSHD-------------------------------------ETTPN 34
            |.:||::|.|.|:.||.||:|||                                     |..|.
  Rat    96 QILCRYYLHGQCKEGDNCRYSHDLSGRRKARGGQDSQPRASADRGPKMATHWEPPTQEVAEAPPT 160

  Fly    35 DNQS--PQISEIAD------EV-----------------VENEQVVASTSSYSRQMTWANAPEFV 74
            .:.|  |.|...|:      |:                 ::|..:.|..:..:....|..|.|||
  Rat   161 ASSSSLPLIGSAAERGFSEAEIDNAGIGSAAERGFPEAEIDNAGLAAGAAGGAGAEGWEGAIEFV 225

  Fly    75 P--RYKAN-------SADFQATEGVQD-----------ICPYG--GSCIWGSKCSYPLHMEICKM 117
            |  .|:..       .|..|:.|..::           :|.|.  |.|:.|.:|:|| |.|||.|
  Rat   226 PGQPYRGRMIPPHGPEAPLQSPEIEREHMAMGMGMPLPLCRYAARGQCLRGDRCAYP-HGEICDM 289

  Fly   118 CDLYCLHPMDQNQRRAHNRECLEQHEQAMELSFAIARSKDKMCGICFDTVVEKKG-RERRFGILS 181
            |....|||.|..|:.||.|.|:|.||:.||||||:.||.||:||||.:.|.||.. .:||||||.
  Rat   290 CGQQALHPWDAAQQEAHRRACVEAHERDMELSFAVQRSMDKVCGICMEVVYEKADPSDRRFGILF 354

  Fly   182 KCKHIFCLTCIRTWRQAHQFEATVTRGCPECRVFSEFVCPSAYWVDTKEEKDKLLSEYRAAMGAK 246
            .|.|.:||.|||.||.|.|||..:::.||:|||.|.||.||.:||:.:|||:||:.:|:..|..|
  Rat   355 SCNHTYCLKCIRRWRSATQFENRISKSCPQCRVSSGFVIPSEFWVEEEEEKEKLVQQYKEGMSQK 419

  Fly   247 DCKYFNGGLGKCPFGNKCFYRH 268
            .|:||.||||.||||..|||:|
  Rat   420 ACRYFAGGLGHCPFGEFCFYKH 441

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 13/60 (22%)
PHA03096 <80..239 CDD:222981 82/180 (46%)
RING 159..213 CDD:238093 29/55 (53%)
Mkrn3XP_218735.6 ZnF_C3H1 93..119 CDD:214632 13/23 (57%)
RING 332..386 CDD:238093 29/54 (54%)
MKRN1_C 452..527 CDD:292443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1388677at2759
OrthoFinder 1 1.000 FOG0000573
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11224
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.