DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5347 and Mkrn3

DIOPT Version :9

Sequence 1:NP_572970.1 Gene:CG5347 / 32403 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:XP_038956927.1 Gene:Mkrn3 / 292988 RGDID:1311197 Length:528 Species:Rattus norvegicus


Alignment Length:347 Identity:129/347 - (37%)
Similarity:171/347 - (49%) Gaps:86/347 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QTICRFHLLGICRFGDLCRFSHD-------------------------------------ETTPN 34
            |.:||::|.|.|:.||.||:|||                                     |..|.
  Rat    95 QILCRYYLHGQCKEGDNCRYSHDLSGRRKARGGQDSQPRASADRGPKMATHWEPPTQEVAEAPPT 159

  Fly    35 DNQS--PQISEIAD------EV-----------------VENEQVVASTSSYSRQMTWANAPEFV 74
            .:.|  |.|...|:      |:                 ::|..:.|..:..:....|..|.|||
  Rat   160 ASSSSLPLIGSAAERGFSEAEIDNAGIGSAAERGFPEAEIDNAGLAAGAAGGAGAEGWEGAIEFV 224

  Fly    75 P--RYKAN-------SADFQATEGVQD-----------ICPYG--GSCIWGSKCSYPLHMEICKM 117
            |  .|:..       .|..|:.|..::           :|.|.  |.|:.|.:|:|| |.|||.|
  Rat   225 PGQPYRGRMIPPHGPEAPLQSPEIEREHMAMGMGMPLPLCRYAARGQCLRGDRCAYP-HGEICDM 288

  Fly   118 CDLYCLHPMDQNQRRAHNRECLEQHEQAMELSFAIARSKDKMCGICFDTVVEKKG-RERRFGILS 181
            |....|||.|..|:.||.|.|:|.||:.||||||:.||.||:||||.:.|.||.. .:||||||.
  Rat   289 CGQQALHPWDAAQQEAHRRACVEAHERDMELSFAVQRSMDKVCGICMEVVYEKADPSDRRFGILF 353

  Fly   182 KCKHIFCLTCIRTWRQAHQFEATVTRGCPECRVFSEFVCPSAYWVDTKEEKDKLLSEYRAAMGAK 246
            .|.|.:||.|||.||.|.|||..:::.||:|||.|.||.||.:||:.:|||:||:.:|:..|..|
  Rat   354 SCNHTYCLKCIRRWRSATQFENRISKSCPQCRVSSGFVIPSEFWVEEEEEKEKLVQQYKEGMSQK 418

  Fly   247 DCKYFNGGLGKCPFGNKCFYRH 268
            .|:||.||||.||||..|||:|
  Rat   419 ACRYFAGGLGHCPFGEFCFYKH 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 13/59 (22%)
PHA03096 <80..239 CDD:222981 82/179 (46%)
RING 159..213 CDD:238093 28/54 (52%)
Mkrn3XP_038956927.1 zf-CCCH_4 96..117 CDD:407881 10/20 (50%)
PHA03096 <272..420 CDD:222981 79/148 (53%)
RING-HC_MKRN1_3 328..388 CDD:319644 33/59 (56%)
MKRN1_C 442..528 CDD:406294
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I7980
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 254 1.000 Inparanoid score I3107
OMA 1 1.010 - - QHG58455
OrthoDB 1 1.010 - - D1388677at2759
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 1 1.000 - - mtm9084
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X837
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.