DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5347 and mkrn3

DIOPT Version :9

Sequence 1:NP_572970.1 Gene:CG5347 / 32403 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001135584.1 Gene:mkrn3 / 100216134 XenbaseID:XB-GENE-5958700 Length:370 Species:Xenopus tropicalis


Alignment Length:340 Identity:89/340 - (26%)
Similarity:132/340 - (38%) Gaps:110/340 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CRFHLLGICRFGDLCRFSHDET------------------------------------------- 31
            ||....|.||:|:.|||||:..                                           
 Frog    14 CRAFNRGSCRWGENCRFSHERKFAQICRHFQNGFCVYGEKCSYQHVLRPPHPPHYLTGRRVSEPC 78

  Fly    32 ----TPNDNQS-----PQISEIADEVVENEQVVASTSSYSRQMTWANAPEFVPRY-----KANSA 82
                .|..|::     |.:..:...|...|     |...|.:..||.|.||:||:     ..:|.
 Frog    79 ILPHVPEHNEARRGSEPSVPPLKLSVEHKE-----TLPPSGRENWALAAEFIPRHSGLIRSVSSP 138

  Fly    83 DFQATEGVQDI---CPYGGSCIWGSKCSYPLHMEICKMCDLYCLHPMDQNQRRAHNRECLE--QH 142
            ..|....:..:   |.       |.|.:..|                    :..::::|..  |:
 Frog   139 TLQHEASISTLVKRCE-------GIKSTTSL--------------------KNLNSQKCTSDLQY 176

  Fly   143 EQAMELSFAIARSKDKMCGICFDTVVEKKGRERRFGILSKCKHIFCLTCIRTWRQAHQFEATVTR 207
            |          ||:|.:||||.|.|.||:..||.||||..|.|.:|:.||:.||:...|:..|.:
 Frog   177 E----------RSRDVVCGICMDKVYEKQVAERVFGILPNCSHAYCVGCIKRWRKTRDFQNEVIK 231

  Fly   208 GCPECRVFSEFVCPSAYWVDTKEEKDKLLSEYRAAMGAKDCKYFNGGLGKCPFGNKCFY------ 266
            |||:||:.|.:..|:.|||....||.||:..::|......|::|..|.|.|||.::|.|      
 Frog   232 GCPQCRIKSSYFIPNKYWVGDSAEKAKLIETFKAKTSKIRCRFFIRGNGHCPFKSECIYLHEIPS 296

  Fly   267 RHHRRCDDNQTQSNA 281
            ||.:|....|.:.:|
 Frog   297 RHQQRKRREQRRRSA 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 11/19 (58%)
PHA03096 <80..239 CDD:222981 49/163 (30%)
RING 159..213 CDD:238093 26/53 (49%)
mkrn3NP_001135584.1 YTH1 <9..>60 CDD:227416 11/45 (24%)
zf-CCCH_4 14..33 CDD:375512 10/18 (56%)
RING-HC_MKRN4 181..240 CDD:319646 29/58 (50%)
RING-HC finger (C3HC4-type) 184..236 CDD:319646 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1388677at2759
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.