DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5347 and mkrn3

Sequence 1:NP_572970.1 Gene:CG5347 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001135584.1 Gene:mkrn3 XenbaseID:XB-GENE-5958700 Length:370 Species:Xenopus tropicalis

Alignment Length:340 Identity:89/341 (26%)
Similarity:132/341 (39%) Gaps:110/341 (32%)


  Fly    10 CRFHLLGICRFGDLCRFSHDET------------------------------------------- 31
            ||....|.||:|:.|||||:..                                           
 Frog    14 CRAFNRGSCRWGENCRFSHERKFAQICRHFQNGFCVYGEKCSYQHVLRPPHPPHYLTGRRVSEPC 78

  Fly    32 ----TPNDNQS-----PQISEIADEVVENEQVVASTSSYSRQMTWANAPEFVPRY-----KANSA 82
                .|..|::     |.:..:...|...|     |...|.:..||.|.||:||:     ..:|.
 Frog    79 ILPHVPEHNEARRGSEPSVPPLKLSVEHKE-----TLPPSGRENWALAAEFIPRHSGLIRSVSSP 138

  Fly    83 DFQATEGVQDI---CPYGGSCIWGSKCSYPLHMEICKMCDLYCLHPMDQNQRRAHNRECLE--QH 142
            ..|....:..:   |.       |.|.:..|                    :..::::|..  |:
 Frog   139 TLQHEASISTLVKRCE-------GIKSTTSL--------------------KNLNSQKCTSDLQY 176

  Fly   143 EQAMELSFAIARSKDKMCGICFDTVVEKKGRERRFGILSKCKHIFCLTCIRTWRQAHQFEATVTR 207
            |          ||:|.:||||.|.|.||:..||.||||..|.|.:|:.||:.||:...|:..|.:
 Frog   177 E----------RSRDVVCGICMDKVYEKQVAERVFGILPNCSHAYCVGCIKRWRKTRDFQNEVIK 231

  Fly   208 GCPECRVFSEFVCPSAYWVDTKEEKDKLLSEYRAAMGAKDCKYFNGGLGKCPFGNKCFY------ 266
            |||:||:.|.:..|:.|||....||.||:..::|......|::|..|.|.|||.::|.|      
 Frog   232 GCPQCRIKSSYFIPNKYWVGDSAEKAKLIETFKAKTSKIRCRFFIRGNGHCPFKSECIYLHEIPS 296

  Fly   267 RHHRRCDDNQTQSNA 281
            ||.:|....|.:.:|
 Frog   297 RHQQRKRREQRRRSA 311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 11/20 (55%)
PHA03096 <80..239 CDD:222981 49/164 (30%)
RING 159..213 CDD:238093 27/54 (50%)
mkrn3NP_001135584.1 ZnF_C3H1 37..60 CDD:214632 0/23 (0%)
RING 184..237 CDD:238093 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47146090
eggNOG 1 0.900 E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1388677at2759
OrthoFinder 1 1.000 FOG0000573
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.710

Return to query results.
Submit another query.