DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5321 and JLP1

Sequence 1:NP_001285244.1 Gene:CG5321 FlyBaseID:FBgn0030575 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_013043.1 Gene:JLP1 SGDID:S000003980 Length:412 Species:Saccharomyces cerevisiae

Alignment Length:402 Identity:83/403 (21%)
Similarity:130/403 (32%) Gaps:139/403 (34%)


  Fly    72 KLDWDNFDTRIRPVSLQTDEQSKEVLVKWSDAHESRFSLKWLKERCFEPDKQQEYL-----RDFY 131
            |..:.||||....   ..||.|...|:|             :::...|..|..:||     .:.|
Yeast    34 KQGYGNFDTHFYD---GQDEVSPSGLLK-------------IRKSYREKSKYPDYLPTWDPTEKY 82

  Fly   132 RPTTRHWSGAEFQDIAQHF--SYDEVMSQDSVLMQWLQ------ALAIYGVAL--LRGAPLDE-- 184
            .|...|    |:.|.|...  ::..:.::::|....::      .|.|.|:.|  |..|..||  
Yeast    83 GPLEFH----EYHDPALRADGNFSNLFAKENVGQLKVKKITPKLGLEINGIQLTDLSDAAKDELA 143

  Fly   185 ------GVV----RRLADRVGFIRRTTYGEEF-------------------VVQAKPGAQNFAYL 220
                  |||    :..||. |....|.||..|                   :...:|.|:.||.:
Yeast   144 LLVAQKGVVVFRNQNFADE-GPDYVTEYGRHFGKLHIHQTSGHPQNNPELHITFRRPDAEEFARV 207

  Fly   221 ----SLTLPLHTDLPYYEYKPSVNILHCVVQTDSPGGSNMLVDGFHVADLLRRDHP-EDFERLSR 280
                :.:...|||:. ||.:|.......||:....||..:..|.....|.|.:  | :||.....
Yeast   208 FDDSTSSGGWHTDVS-YELQPPSYTFFSVVEGPDGGGDTLFADTIEAFDRLSK--PLQDFLSTLH 269

  Fly   281 IVVDWNDIGSEDGREFHNIWRAPVICLDEEGRYTRINHSVPQRDSHFNVPLEEVLPWYESYALFV 345
            ::....:......|:.....||||                    :|.: ||..|.|..:...|:|
Yeast   270 VIHSSKEQAENSQRQGGIKRRAPV--------------------THIH-PLVRVHPVLKKKCLYV 313

  Fly   346 RLA-----------------------IADSHAFKTR----PGDVLTFNNIRLLHGRTGYDDSEES 383
            ..|                       :..||..:.|    |..|:.::|.|:.|           
Yeast   314 NRAFSRKIVELKRQESESLLNFLYNLVESSHDLQLRAKWEPHSVVIWDNRRVQH----------- 367

  Fly   384 PRYIVGAYLDWD 395
                 .|.:||:
Yeast   368 -----SAVIDWE 374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5321NP_001285244.1 DUF971 <48..113 CDD:294847 10/41 (24%)
carnitine_bodg 49..405 CDD:274118 83/403 (21%)
CAS_like 127..395 CDD:238154 70/346 (20%)
JLP1NP_013043.1 TauD 112..396 CDD:225086 62/305 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2175
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.