DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5321 and BBOX1

Sequence 1:NP_001285244.1 Gene:CG5321 FlyBaseID:FBgn0030575 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_003977.1 Gene:BBOX1 HGNCID:964 Length:387 Species:Homo sapiens

Alignment Length:362 Identity:143/363 (39%)
Similarity:208/363 (57%) Gaps:9/363 (2%)


  Fly    49 FPGIWLRDNCMCEDCFHGSSKSRKLDWDNFDTRIRPVSLQTDEQSKEVLVKWSDAHESRFSLKWL 113
            :|.:||||||.|.||:..|:|:|||..:..|..|....|..|.  |:|.:.|.|.|.|.|...||
Human    29 YPAVWLRDNCPCSDCYLDSAKARKLLVEALDVNIGIKGLIFDR--KKVYITWPDEHYSEFQADWL 91

  Fly   114 KERCFEPDKQQEYLRDFYRPTTRHWSGAEFQDIAQHFSYDEVMSQDSVLMQWLQALAIYGVALLR 178
            |:|||....:.:..|:.:.|..::| |:|.|  .....:::|:..|....:||..|...|:..|.
Human    92 KKRCFSKQARAKLQRELFFPECQYW-GSELQ--LPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLT 153

  Fly   179 GAPLDEGVVRRLADRVGFIRRTTYGEEFVVQAKPGAQNFAYLSLTLPLHTDLPYYEYKPSVNILH 243
            ||....|.|.:|..|:||:..|.||..:.||.|..|.|.||.:..|..|||.|...:.|.|.:||
Human   154 GASDKPGEVSKLGKRMGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLH 218

  Fly   244 CVVQTDSPGGSNMLVDGFHVADLLRRDHPEDFERLSRIVVDWNDIGSEDGREFHNIWRAPVICLD 308
            |:.||.: ||.:.:||||:|...|::::|:.|:.||...||:.||| .|..:|....:..:|.||
Human   219 CIKQTVT-GGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIG-VDYCDFSVQSKHKIIELD 281

  Fly   309 EEGRYTRINHSVPQRDSHFNVPLEEVLPWYESYALFVRL--AIADSHAFKTRPGDVLTFNNIRLL 371
            ::|:..|||.:...||:.|:||:|.|.|:|.:...||.|  :......||..||||:||:|.|||
Human   282 DKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLL 346

  Fly   372 HGRTGYDDSEESPRYIVGAYLDWDIIYSRLRVLKKRL 408
            |||..|:...|..|::.|||.|||::.||||:|::|:
Human   347 HGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRV 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5321NP_001285244.1 DUF971 <48..113 CDD:294847 27/64 (42%)
carnitine_bodg 49..405 CDD:274118 142/358 (40%)
CAS_like 127..395 CDD:238154 104/270 (39%)
BBOX1NP_003977.1 carnitine_bodg 16..381 CDD:274118 142/359 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C275471885
eggNOG 1 0.900 E1_COG2175
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H2967
Inparanoid 1 1.050 260 1.000 Inparanoid score I3069
Isobase 1 0.950 0.909372 Normalized mean entropy S3503
OMA 1 1.010
OrthoDB 1 1.010 D534559at33208
OrthoFinder 1 1.000 FOG0001127
OrthoInspector 1 1.000 T609212
orthoMCL 1 0.900 OOG5_129640
Panther 1 1.100 O PTHR10696
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2023
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.750

Return to query results.
Submit another query.