DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5321 and Bbox1

Sequence 1:NP_001285244.1 Gene:CG5321 FlyBaseID:FBgn0030575 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_072151.1 Gene:Bbox1 RGDID:619756 Length:387 Species:Rattus norvegicus

Alignment Length:362 Identity:141/363 (39%)
Similarity:210/363 (58%) Gaps:9/363 (2%)


  Fly    49 FPGIWLRDNCMCEDCFHGSSKSRKLDWDNFDTRIRPVSLQTDEQSKEVLVKWSDAHESRFSLKWL 113
            :|.:||||||.|.||:..|:|:|||..:..|..||...|..|:  |:|.:.|.:.|.|.|...||
  Rat    29 YPAVWLRDNCQCSDCYLHSAKARKLLLEALDVNIRMDDLTFDQ--KKVYITWPNGHYSEFEANWL 91

  Fly   114 KERCFEPDKQQEYLRDFYRPTTRHWSGAEFQDIAQHFSYDEVMSQDSVLMQWLQALAIYGVALLR 178
            |:|||..:.:.....:.:.|..::| |:|.|  ....::::|::.|....:||.:|...|:..|.
  Rat    92 KKRCFSQEARAGLQGELFLPECQYW-GSELQ--LPTLNFEDVLNDDDHAYKWLSSLKKVGIVRLT 153

  Fly   179 GAPLDEGVVRRLADRVGFIRRTTYGEEFVVQAKPGAQNFAYLSLTLPLHTDLPYYEYKPSVNILH 243
            ||....|.:.:|..|:||:..|.||..:.||.|..|.|.||.:..|..|||.|...:.|.|.:||
  Rat   154 GAADKRGEIIKLGKRIGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLH 218

  Fly   244 CVVQTDSPGGSNMLVDGFHVADLLRRDHPEDFERLSRIVVDWNDIGSEDGREFHNIWRAPVICLD 308
            |:.||.: ||.:.:||||:|...|:..:|:.|..||...||:.||| .|..:|....:..:|.||
  Rat   219 CIKQTVT-GGDSEIVDGFNVCQKLKEKNPQAFSILSSTFVDFTDIG-VDYCDFSVQSKHKIIELD 281

  Fly   309 EEGRYTRINHSVPQRDSHFNVPLEEVLPWYESYALFVRLAIAD--SHAFKTRPGDVLTFNNIRLL 371
            ::|:..|||.:...||:.|:||:|.|.|:|.:...||.|..:.  .:.||..||||:||:|.|||
  Rat   282 DKGQVVRINFNNATRDTVFDVPIERVQPFYAALKEFVDLMNSKEYKYTFKMNPGDVITFDNWRLL 346

  Fly   372 HGRTGYDDSEESPRYIVGAYLDWDIIYSRLRVLKKRL 408
            |||..|:...|..|::.|||.|||::.||||:|::|:
  Rat   347 HGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRV 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5321NP_001285244.1 DUF971 <48..113 CDD:294847 27/64 (42%)
carnitine_bodg 49..405 CDD:274118 140/358 (39%)
CAS_like 127..395 CDD:238154 102/270 (38%)
Bbox1NP_072151.1 DUF971 15..82 CDD:294847 23/55 (42%)
carnitine_bodg 16..381 CDD:274118 140/359 (39%)
CAS_like 107..370 CDD:238154 102/268 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C275472756
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H2967
Inparanoid 1 1.050 262 1.000 Inparanoid score I2958
OMA 1 1.010
OrthoDB 1 1.010 D534559at33208
OrthoFinder 1 1.000 FOG0001127
OrthoInspector 1 1.000 T618152
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10696
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
99.010

Return to query results.
Submit another query.