DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5321 and bbox1

Sequence 1:NP_001285244.1 Gene:CG5321 FlyBaseID:FBgn0030575 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_005168960.1 Gene:bbox1 ZFINID:ZDB-GENE-050417-218 Length:433 Species:Danio rerio

Alignment Length:410 Identity:158/411 (38%)
Similarity:227/411 (55%) Gaps:19/411 (5%)


  Fly     4 PRLLGRSL--SQLKTINSAQFSRQISAKIVNESSIEVQPEANSKPLTFPGIWLRDNCMCEDCFHG 66
            ||:..::|  :.|.....:...||..| :..|..:::..:..|..| :|..||||||.|..|...
Zfish    30 PRIGNQTLAAAPLPFAGGSPGVRQARA-LDQERLLQIDWDDGSCSL-YPFTWLRDNCQCPLCTLQ 92

  Fly    67 SSKSRKLDWDNFD--TRIRPVSLQTDEQSKEVLVKWSDAHESRFSLKWLKERCFEPDKQQEYLRD 129
            |:::|.|.:.:.|  |.:..|.|    ...:|.:.|.|.|.|.|...|||:|||..:.:|....:
Zfish    93 SAQARSLLFSHLDVHTGMDHVQL----MDNKVSITWPDQHSSEFDPDWLKKRCFSSEARQALQEE 153

  Fly   130 FYRPTTRHW-SGAEFQDIAQHFSYDEVMSQDSVLMQWLQALAIYGVALLRGAPLDEGVVRRLADR 193
            .:.....:| ||.:....    .::||:..|...:.||:||...|:..|||||.::|.:.||:.|
Zfish   154 LFLNEREYWDSGLQIPTA----DFEEVLHDDKAALAWLEALRRIGIVYLRGAPAEQGQLARLSQR 214

  Fly   194 VGFIRRTTYGEEFVVQAKPGAQNFAYLSLTLPLHTDLPYYEYKPSVNILHCVVQTDSPGGSNMLV 258
            :|::|.|.||..:.||.||.|.|.||.|..|.||||.|...:.|.|..||||.|.|. ||.:.:|
Zfish   215 IGYLRLTFYGHTWQVQDKPMANNVAYTSGELSLHTDYPALHHPPGVQFLHCVRQADE-GGESEVV 278

  Fly   259 DGFHVADLLRRDHPEDFERLSRIVVDWNDIGSEDGREFHNIWRAPVICLDEEGRYTRINHSVPQR 323
            ||||:|:.|||:.||.|..||.:.||:.|.|: |..:|....:..:|.:|..||..|||::...|
Zfish   279 DGFHMAEQLRREDPEAFNILSSLRVDFTDSGA-DYCDFSVQSKNHIIDVDSSGRVVRINYNNATR 342

  Fly   324 DSHFNVPLEEVLPWYESYALFVRLAIADSHAFKTR--PGDVLTFNNIRLLHGRTGYDDSEESPRY 386
            ||..::||.:|.|:|.|...||.|.....:.|..|  ||||:||:|.||||||..|....::.|:
Zfish   343 DSVLDLPLHQVQPFYSSLKAFVELLSRPENVFTYRMEPGDVVTFDNWRLLHGRKSYQSRGQNLRH 407

  Fly   387 IVGAYLDWDIIYSRLRVLKK 406
            :.|||||||.:.||||:|:|
Zfish   408 LEGAYLDWDEVMSRLRILRK 427

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5321NP_001285244.1 DUF971 <48..113 CDD:294847 23/67 (34%)
carnitine_bodg 49..405 CDD:274118 147/361 (41%)
CAS_like 127..395 CDD:238154 112/271 (41%)
bbox1XP_005168960.1 TauD 62..426 CDD:331497 149/375 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C275471759
eggNOG 1 0.900 E1_COG2175
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H2967
Inparanoid 1 1.050 265 1.000 Inparanoid score I2981
OMA 1 1.010
OrthoDB 1 1.010 D534559at33208
OrthoFinder 1 1.000 FOG0001127
OrthoInspector 1 1.000 T596794
orthoMCL 1 0.900 OOG5_129640
Panther 1 1.100 O PTHR10696
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2023
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.