DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5321 and tmlhe

Sequence 1:NP_001285244.1 Gene:CG5321 FlyBaseID:FBgn0030575 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_682831.3 Gene:tmlhe ZFINID:ZDB-GENE-091204-144 Length:410 Species:Danio rerio

Alignment Length:365 Identity:107/366 (29%)
Similarity:170/366 (46%) Gaps:27/366 (7%)


  Fly    49 FPGIWLRDNCMCEDCFHGSSKSRKLDWDNFDTRIRPVSLQTDEQSKEVLVKWSDAHESRFSLKWL 113
            |..:||||:|....|::..:..|.||..:.|..|||...:.||.:  :.:.|.|.|.:|::|.||
Zfish    60 FDYVWLRDHCRSASCYNSKTNQRNLDTASIDLTIRPSKSRVDEHN--LFLTWPDGHVTRYNLAWL 122

  Fly   114 KERCFEPDKQQEYLRDFYRPTTRHWSGAEFQDI-AQHFSYDEVMSQDSVLMQWLQALAIYGVALL 177
            .:..:|..     :|...:|... |:...:... ....::|:.||.|..|..:|....:||:|.:
Zfish   123 AQNSYEGQ-----MRSAIQPRIL-WNAHIYSSAKVPAANWDKFMSCDEELKNFLNNFLLYGIAFV 181

  Fly   178 RGAPLDEGVVRRLADRVGFIRRTTYGEEFVVQAKPGAQNFAYLSLTLPLHTDLPYYEYKPSVNIL 242
            .|.|........:..||..||.|.||..:...:.....:.||..|.|..|||..|::....:.:.
Zfish   182 EGVPPTLEATETVTQRVSLIRETIYGRMWNFTSDFSRGDTAYTKLALDRHTDTSYFQEPCGIQVF 246

  Fly   243 HCVVQTDSPGGSNMLVDGFHVADLLRRDHPEDFERLSRIVVDWNDIGSEDGREFHNIWRAPVICL 307
            || ::.:..||..:||||||.||.:.:..||:|:.||.:.:..:.:.:......|.|...||:.:
Zfish   247 HC-LRHEGTGGRTLLVDGFHAADTVLQQTPENFQLLSHVPIKHDYVENLSDHRNHMIGIGPVLNV 310

  Fly   308 ---DEEG---RYTRINHSVPQRDSHFNVPLEEVLPWYESY-ALFVRLAIADSHAF-KTRPGDVLT 364
               :.|.   ||...:.||..     .||.:.|..||.:: .|...|..||:..: |.:||.||.
Zfish   311 YPWNNEVYMIRYNNYDRSVIN-----TVPHDVVRRWYVAHRKLTAELRRADNELWVKLKPGKVLF 370

  Fly   365 FNNIRLLHGRTGYDDSEESPRYIVGAYLDWDIIYSRLRVL 404
            .:|.|:||||    :|....|.:.|.||..|.:.:..|.|
Zfish   371 VDNWRVLHGR----ESFTGLRQLCGCYLTRDDVLNTARSL 406

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5321NP_001285244.1 DUF971 <48..113 CDD:294847 22/64 (34%)
carnitine_bodg 49..405 CDD:274118 107/366 (29%)
CAS_like 127..395 CDD:238154 80/277 (29%)
tmlheXP_682831.3 DUF971 49..122 CDD:294847 22/64 (34%)
carnitine_TMLD 60..408 CDD:274119 107/366 (29%)
CAS_like 132..397 CDD:238154 80/276 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2175
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D534559at33208
OrthoFinder 1 1.000 FOG0001127
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2023
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.