DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5321 and TMLHE

Sequence 1:NP_001285244.1 Gene:CG5321 FlyBaseID:FBgn0030575 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_060666.1 Gene:TMLHE HGNCID:18308 Length:421 Species:Homo sapiens

Alignment Length:373 Identity:112/374 (30%)
Similarity:183/374 (49%) Gaps:39/374 (10%)


  Fly    47 LTFPGIWLRDNCMCEDCFHGSSKSRKLDWDNFDTRIRPVSLQTDEQSKEVLVKWSDAHESRFSLK 111
            :.|..:||||:|....|::..:..|.||..:.|..|:|.:::.||.:  :...|.|.|.:::.|.
Human    69 MRFDYVWLRDHCRSASCYNSKTHQRSLDTASVDLCIKPKTIRLDETT--LFFTWPDGHVTKYDLN 131

  Fly   112 WLKERCFEPDKQQEYLRDFYRPTTRHWSGAEFQDIAQHFSYD--EVMSQDSVLMQWLQALAIYGV 174
            ||.:..:|..||:     ..:|... |: ||....||..|.|  ..:..:..|.::||...:||:
Human   132 WLVKNSYEGQKQK-----VIQPRIL-WN-AEIYQQAQVPSVDCQSFLETNEGLKKFLQNFLLYGI 189

  Fly   175 ALLRGAPLDEGVVRRLADRVGFIRRTTYGEEFVVQAKPGAQNFAYLSLTLPLHTDLPYYEYKPSV 239
            |.:...|..:....:||:|:..||.|.||..:...:.....:.||..|.|..|||..|::....:
Human   190 AFVENVPPTQEHTEKLAERISLIRETIYGRMWYFTSDFSRGDTAYTKLALDRHTDTTYFQEPCGI 254

  Fly   240 NILHCVVQTDSPGGSNMLVDGFHVADLLRRDHPEDFERLSRIVVDWNDIGSEDGREFHN--IWRA 302
            .:.|| ::.:..||..:|||||:.|:.:.:..||:||.||::.:....|  ||..|.||  |...
Human   255 QVFHC-LKHEGTGGRTLLVDGFYAAEQVLQKAPEEFELLSKVPLKHEYI--EDVGECHNHMIGIG 316

  Fly   303 PVICL---DEE---GRYTRINHSVPQRDSHFNVPLEEVLPWYESY-ALFVRLAIADSHAF-KTRP 359
            ||:.:   ::|   .||...:.:|..     .||.:.|..||.:: .|.:.|...::..: |.:|
Human   317 PVLNIYPWNKELYLIRYNNYDRAVIN-----TVPYDVVHRWYTAHRTLTIELRRPENEFWVKLKP 376

  Fly   360 GDVLTFNNIRLLHGR---TGYDDSEESPRYIVGAYLDWDIIYSRLRVL 404
            |.||..:|.|:||||   |||       |.:.|.||..|.:.:..|:|
Human   377 GRVLFIDNWRVLHGRECFTGY-------RQLCGCYLTRDDVLNTARLL 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5321NP_001285244.1 DUF971 <48..113 CDD:294847 20/65 (31%)
carnitine_bodg 49..405 CDD:274118 112/372 (30%)
CAS_like 127..395 CDD:238154 85/283 (30%)
TMLHENP_060666.1 carnitine_TMLD 70..419 CDD:274119 112/373 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2175
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D534559at33208
OrthoFinder 1 1.000 FOG0001127
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2023
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.