DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5321 and CG14630

Sequence 1:NP_001285244.1 Gene:CG5321 FlyBaseID:FBgn0030575 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_651985.1 Gene:CG14630 FlyBaseID:FBgn0014903 Length:406 Species:Drosophila melanogaster

Alignment Length:373 Identity:184/374 (49%)
Similarity:267/374 (71%) Gaps:5/374 (1%)


  Fly    36 IEVQPEANSKPLTFPGIWLRDNCMCEDCFHGSSKSRKLDWDNFDTRIRPVS-LQTDEQSKEVLVK 99
            :|||.|..:. |.:|.:||||||.|.:|||.::::||..||.....| ||| :..:::.|::.:.
  Fly    30 VEVQEEQGNL-LKYPQVWLRDNCQCAECFHAATRARKSHWDRGPLNI-PVSQVAYNKERKQLEII 92

  Fly   100 WSDAHESRFSLKWLKERCFEPDKQQEYLRDFYRPTTRHWSGAEFQDIAQHFSYDEVMSQDSVLMQ 164
            |.|.|.|.|.|.||:||.|....::.||.:.|:|..:.|...||:|:.:.|.|::|:.||:.|..
  Fly    93 WQDKHRSTFDLGWLRERDFGETGRKHYLEEVYKPPAQLWGKTEFEDVKREFQYEDVLEQDAALRV 157

  Fly   165 WLQALAIYGVALLRGAPLDEGVVRRLADRVGFIRRTTYGEEFVVQAKPGAQNFAYLSLTLPLHTD 229
            ||:|||:.|.|:|:|||.|..|.::||:|:|:|:|||||:.|.|::||.|:|:|||...||||||
  Fly   158 WLEALAVQGFAILKGAPNDINVAKKLAERIGYIKRTTYGDVFEVKSKPNARNYAYLMTPLPLHTD 222

  Fly   230 LPYYEYKPSVNILHCVVQTDSPGGSNMLVDGFHVADLLRRDHPEDFERLSRIVVDWNDIG--SED 292
            :||||||..:||||.:||::|.||:|.|.|||:||..|::.||||||.|..:.|:|.|||  .:|
  Fly   223 MPYYEYKAGINILHTLVQSESKGGANTLTDGFNVASQLQKLHPEDFEVLKSVPVNWFDIGHDGDD 287

  Fly   293 GREFHNIWRAPVICLDEEGRYTRINHSVPQRDSHFNVPLEEVLPWYESYALFVRLAIADSHAFKT 357
            .:.||::|||||||||.:||:.|||.:..:|||.|:|.|.:.:.||::|..|:.:|.:::..|||
  Fly   288 SKPFHSLWRAPVICLDVDGRFARINQNTTKRDSRFSVSLAQAVSWYKAYDKFLEIAQSEAVEFKT 352

  Fly   358 RPGDVLTFNNIRLLHGRTGYDDSEESPRYIVGAYLDWDIIYSRLRVLK 405
            :.|||..|||:|:|||||.|:|:..:.|::||||:|||||||:||.||
  Fly   353 QAGDVFVFNNLRMLHGRTAYEDAPGNKRHLVGAYVDWDIIYSKLRTLK 400

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5321NP_001285244.1 DUF971 <48..113 CDD:294847 27/66 (41%)
carnitine_bodg 49..405 CDD:274118 178/359 (50%)
CAS_like 127..395 CDD:238154 138/270 (51%)
CG14630NP_651985.1 carnitine_bodg 30..400 CDD:274118 183/372 (49%)
DUF971 <41..107 CDD:294847 28/67 (42%)
CAS_like 120..390 CDD:238154 138/270 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C275470988
eggNOG 1 0.900 E1_COG2175
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 186 1.000 Inparanoid score I2568
Isobase 1 0.950 0.909372 Normalized mean entropy S3503
OrthoDB 1 1.010 D534559at33208
OrthoFinder 1 1.000 FOG0001127
orthoMCL 1 0.900 OOG5_129640
Panther 1 1.100 P PTHR10696
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2023
98.870

Return to query results.
Submit another query.