DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5321 and CG4335

Sequence 1:NP_001285244.1 Gene:CG5321 FlyBaseID:FBgn0030575 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_650886.1 Gene:CG4335 FlyBaseID:FBgn0038795 Length:364 Species:Drosophila melanogaster

Alignment Length:371 Identity:104/372 (28%)
Similarity:169/372 (45%) Gaps:30/372 (8%)


  Fly    44 SKPLTFPGIWLRDNCMCEDCFHGSSKSRKLDWDNFDTRIRPVSLQTDEQSKEVLVKWSDAHESRF 108
            |:.:.....||||:|.|.:|.:..:..|:.|..:....|.|:.::.|..:.:  |:|||||:|.:
  Fly    10 SQSIEINEFWLRDHCRCVECLNFETNQRRYDVLDLPADIMPLDVKYDGMNLQ--VQWSDAHKSNY 72

  Fly   109 SLKWLKERCFEPDKQQEYL--RDFYRPTTRHWSGAEFQDIAQH--FSYDEVMSQDSVLMQWLQAL 169
            .|.::.      |.|.|.|  |.........|:.:......:|  |...:::|.|:.:...:::|
  Fly    73 DLDFIF------DSQLERLIGRRSKSTNLTPWNRSIILQNERHLRFPLPQLVSSDNEVRSLVESL 131

  Fly   170 AIYGVALLRGAPLDEGVVRRLADRVGFIRRTTYGEEFVVQAKPGAQNFAYLSLTLPLHTDLPYYE 234
            ..||:..:........:......||..:.:|.:||.:.....|...:.||..|.|..|||..|:.
  Fly   132 VRYGIVFIDDVAPTANMTELALRRVFPLMKTFFGEMWTFSDNPDHADTAYTKLYLGSHTDNTYFC 196

  Fly   235 YKPSVNILHCVVQTDSPGGSNMLVDGFHVADLLRRDHPEDFERLSRIVVDWNDIGSEDGREFHNI 299
            ....:..|||:..:.| ||.|..|||.||...|:|.:|..::.|..:.|....|  |.|.  |:.
  Fly   197 DAAGLQALHCIEHSGS-GGENFFVDGLHVVHELKRRYPAAYDVLCSVQVPGEYI--EKGE--HHY 256

  Fly   300 WRAPVICLD---EEGRYTRINHSVPQRDSHFNVPLEEVLPWYESYALFVRLAIADSH---AFKTR 358
            ..||:|.:|   :|....|:|  |..|.....:|..|:..:|:|....: |.:.|..   |.|..
  Fly   257 HTAPIIQVDPLTQEFVQLRLN--VYDRAVFNTIPQAEMAEFYDSLRQLL-LIVRDKQQQWALKLC 318

  Fly   359 PGDVLTFNNIRLLHGRTGYDDSEESPRYIVGAYLDWDIIYSRLRVL 404
            ||.::.|:|.|:||||..|..|    |.:.|:|:......|:.|||
  Fly   319 PGSIVLFDNWRVLHGREAYTGS----RTMSGSYVQRTDFLSKARVL 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5321NP_001285244.1 DUF971 <48..113 CDD:294847 20/65 (31%)
carnitine_bodg 49..405 CDD:274118 103/367 (28%)
CAS_like 127..395 CDD:238154 76/278 (27%)
CG4335NP_650886.1 carnitine_TMLD 19..361 CDD:274119 103/363 (28%)
DUF971 <19..70 CDD:294847 18/53 (34%)
CAS_like 110..350 CDD:294121 72/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C275771001
eggNOG 1 0.900 E1_COG2175
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I1548
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D534559at33208
OrthoFinder 1 1.000 FOG0001127
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10696
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2023
77.020

Return to query results.
Submit another query.