DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5321 and CG10814

Sequence 1:NP_001285244.1 Gene:CG5321 FlyBaseID:FBgn0030575 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_610868.1 Gene:CG10814 FlyBaseID:FBgn0033830 Length:402 Species:Drosophila melanogaster

Alignment Length:375 Identity:205/376 (55%)
Similarity:275/376 (73%) Gaps:1/376 (0%)


  Fly    32 NESSIEVQPEANSKPLTFPGIWLRDNCMCEDCFHGSSKSRKLD-WDNFDTRIRPVSLQTDEQSKE 95
            ::|.:...|:.:.:.:.||.|||||||.||:|:...:.||... |::.||.:|.:....|...:.
  Fly    23 DQSRLVQVPDPDRRDMQFPDIWLRDNCRCEECYLPQTLSRLPQLWNHLDTSVRVLRQSVDVDQRV 87

  Fly    96 VLVKWSDAHESRFSLKWLKERCFEPDKQQEYLRDFYRPTTRHWSGAEFQDIAQHFSYDEVMSQDS 160
            :.::|||.|.|::...||:||.|....:|.||||||||..:.|||.:|:.|.|.|.|.|::..||
  Fly    88 LCIEWSDGHTSQYPFSWLRERDFSYANRQRYLRDFYRPEQKLWSGLDFEKIRQVFYYQELLDCDS 152

  Fly   161 VLMQWLQALAIYGVALLRGAPLDEGVVRRLADRVGFIRRTTYGEEFVVQAKPGAQNFAYLSLTLP 225
            .|.||||.||:||||:::.||||..|:|||::||||:|||||||||.|:|:||..|:|||:..||
  Fly   153 ALQQWLQHLAVYGVAMVKEAPLDMDVLRRLSNRVGFMRRTTYGEEFSVRAQPGGSNYAYLAAPLP 217

  Fly   226 LHTDLPYYEYKPSVNILHCVVQTDSPGGSNMLVDGFHVADLLRRDHPEDFERLSRIVVDWNDIGS 290
            ||||:||:||.|.|.:||.:.|:.||||.|:|.|.|:||:::|..:||.|..|.:..|||.||||
  Fly   218 LHTDMPYFEYLPGVTMLHTLEQSASPGGVNLLADAFYVAEVMRERYPEQFRVLCQTPVDWADIGS 282

  Fly   291 EDGREFHNIWRAPVICLDEEGRYTRINHSVPQRDSHFNVPLEEVLPWYESYALFVRLAIADSHAF 355
            :...:||||||||||.||.|||..|||||:|||||||:||:|:|.||||:.|.||.||...|..|
  Fly   283 DGDLQFHNIWRAPVINLDAEGRCVRINHSIPQRDSHFSVPVEQVRPWYEAMATFVGLAHEHSCRF 347

  Fly   356 KTRPGDVLTFNNIRLLHGRTGYDDSEESPRYIVGAYLDWDIIYSRLRVLK 405
            ||.|||||||:|:||:||||||||::.:.|:|:||::||||:|||||||:
  Fly   348 KTTPGDVLTFDNLRLVHGRTGYDDTDRNVRHILGAFVDWDIVYSRLRVLR 397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5321NP_001285244.1 DUF971 <48..113 CDD:294847 25/66 (38%)
carnitine_bodg 49..405 CDD:274118 203/357 (57%)
CAS_like 127..395 CDD:238154 163/268 (61%)
CG10814NP_610868.1 DUF971 22..106 CDD:283749 28/83 (34%)
carnitine_bodg 27..398 CDD:274118 204/372 (55%)
CAS_like 119..387 CDD:238154 163/268 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C275470960
eggNOG 1 0.900 E1_COG2175
Homologene 1 1.000 H2967
Inparanoid 1 1.050 186 1.000 Inparanoid score I2568
Isobase 1 0.950 0.909372 Normalized mean entropy S3503
OrthoDB 1 1.010 D534559at33208
OrthoFinder 1 1.000 FOG0001127
orthoMCL 1 0.900 OOG5_129640
Panther 1 1.100 P PTHR10696
RoundUp 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.