DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5321 and Tmlhe

Sequence 1:NP_001285244.1 Gene:CG5321 FlyBaseID:FBgn0030575 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_620097.1 Gene:Tmlhe MGIID:2180203 Length:421 Species:Mus musculus

Alignment Length:441 Identity:126/442 (29%)
Similarity:201/442 (45%) Gaps:61/442 (14%)


  Fly     1 MWVPRLL---GRSLSQLKTINSAQ----------FSRQI-----SAKIVN------ESSIEVQPE 41
            ||..:||   .|..:.:|..|.||          ||..|     ::|.||      |..:|:|..
Mouse     1 MWYHKLLHQQSRLRNLMKRGNIAQGLHLSNFKSLFSSSIHWCHTTSKSVNCTWHQHEDHLELQYA 65

  Fly    42 ANSKPLTFPGIWLRDNCMCEDCFHGSSKSRKLDWDNFDTRIRPVSLQTDEQSKEVLVKWSDAHES 106
            ..  .:.|..:||||:|....|::..:..|.||..:.|..|:|.::..||..  :...|.|.|.:
Mouse    66 GT--VMRFDYVWLRDHCRSASCYNSKTHQRSLDTASVDLCIKPKTVHLDETM--LFFTWPDGHVT 126

  Fly   107 RFSLKWLKERCFEPDKQQEYLRDFYRPTTRHWSGAEFQDIAQHFSYDE--VMSQDSVLMQWLQAL 169
            |:.|.||.:..:|..||:     ..:|... |:...:|. ||..|.|.  .:..:..|.::||..
Mouse   127 RYDLDWLVKNSYEGQKQK-----VIQPRIL-WNSKLYQQ-AQVPSVDFQCFLETNEGLKKFLQNF 184

  Fly   170 AIYGVALLRGAPLDEGVVRRLADRVGFIRRTTYGEEFVVQAKPGAQNFAYLSLTLPLHTDLPYYE 234
            .:||:|.:...|..|....:||:|:..||.|.||..:...:.....:.||..|.|..|||..|::
Mouse   185 LLYGIAFVENVPPTEEHTEKLAERISLIRETIYGRMWYFTSDFSRGDTAYTKLALDRHTDTTYFQ 249

  Fly   235 YKPSVNILHCVVQTDSPGGSNMLVDGFHVADLLRRDHPEDFERLSRIVVDWNDIGSEDGREFHNI 299
            ....:.:.|| ::.:..||..:|||||:.|..:.:..||:||.||::.:....|.:......|.|
Mouse   250 EPCGIQVFHC-LKHEGTGGRTLLVDGFYAAQQVLQKAPEEFELLSKVPLKHEYIENVGQCHNHMI 313

  Fly   300 WRAPVICL---DEE---GRYTRINHSVPQRDSHFNVPLEEVLPWYESY-ALFVRLAIADSHAF-K 356
            ...|::.:   ::|   .||...:.:|..     .||.:.|..||.:: .|...|...::..: |
Mouse   314 GVGPILNIYPWNKELYLIRYNNYDRAVIN-----TVPYDVVHRWYTAHRTLTTELRRPENELWVK 373

  Fly   357 TRPGDVLTFNNIRLLHGR---TGYDDSEESPRYIVGAYLDWDIIYSRLRVL 404
            .:||.||..:|.|:||||   |||       |.:.|.||..|.:.:..|:|
Mouse   374 LKPGKVLFIDNWRVLHGRESFTGY-------RQLCGCYLTRDDVLNTARLL 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5321NP_001285244.1 DUF971 <48..113 CDD:294847 21/65 (32%)
carnitine_bodg 49..405 CDD:274118 108/370 (29%)
CAS_like 127..395 CDD:238154 80/281 (28%)
TmlheNP_620097.1 DUF971 54..133 CDD:283749 24/83 (29%)
carnitine_TMLD 70..419 CDD:274119 108/371 (29%)
CAS_like 142..408 CDD:238154 82/286 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2175
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D534559at33208
OrthoFinder 1 1.000 FOG0001127
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2023
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.