DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5321 and gbh-1

Sequence 1:NP_001285244.1 Gene:CG5321 FlyBaseID:FBgn0030575 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_496305.1 Gene:gbh-1 WormBaseID:WBGene00001522 Length:421 Species:Caenorhabditis elegans

Alignment Length:419 Identity:128/420 (30%)
Similarity:200/420 (48%) Gaps:34/420 (8%)


  Fly     9 RSLSQLKTINSAQFSRQISAKIVNESSIEVQPEANSKPLTFPGIWLRDNCMCEDCF--HGSSKSR 71
            |:.|:|.::......|.::.|           .::.|...||.|||||.......:  ..:..:|
 Worm    11 RNASKLASVAGPNSDRIVNVK-----------WSDGKTGVFPLIWLRDTSPDPSTYTISPAMTAR 64

  Fly    72 KLDWDNFDTRIRPVSLQTDEQSKEVLVKWSDAHESRFSLKWLKERCFEPDKQQEYLRDFYRPTTR 136
            ||....||.......|..||.:..:.::|.....|.|..:|||.|.....:.:...|..|....:
 Worm    65 KLTMLEFDVEQNARKLWIDEDANCLKIEWESGVLSEFPSEWLKIRNPSDQEARRRRRKVYLFPEQ 129

  Fly   137 HWSGAEFQDIAQHFSYDEVMSQDSVLMQWLQALAIYGVALLRGAPLD-EGVVRRLADRVGFIRRT 200
            .|..||.:...:.||::|.|..:.|:..:|||:.|.|:|:|:|||.. .|.|..:.||:|.|:||
 Worm   130 TWGKAEIEGKLKKFSHEEFMKNEQVVHDFLQAVCIDGIAVLKGAPQGVRGAVEAIGDRIGMIKRT 194

  Fly   201 TYGEEFVVQAKPGAQNFAYLSL-TLPLHTDLPYYEYKPSVNILHCVVQTDSPGGSNMLVDGFHVA 264
            .:|..|.|..|..|.|.||.|. .||.|||.|...:.|.:.:|| ::|:...||.::.|||||||
 Worm   195 HFGLVFEVSLKADASNMAYASNGGLPFHTDFPSLSHPPQLQMLH-MLQSAEEGGHSLFVDGFHVA 258

  Fly   265 DLLRRDHPEDFERLSRIVVDWNDIGSEDGREFHNI------------WRAPVICLDEEGRYTRIN 317
            :.||.:.||.|:.|:...:::    .|:|.:.|.|            .|..||.|:::|:..:|.
 Worm   259 EQLRVEKPEIFKILTTQSMEY----IEEGYDVHEINGKTIRFDYDMCARHKVIRLNDDGKVNKIQ 319

  Fly   318 HSVPQRDSHFNVPLEEVLPWYESYALFVRLAIADSHAFKTR--PGDVLTFNNIRLLHGRTGYDDS 380
            .....|...::....:|...|.:...|........:..|.|  .||.:.:.|.||||.|.|:.::
 Worm   320 FGNAMRSWFYDCEPSKVQDVYRAMKTFTEYCYQPRNMLKFRLEDGDTVLWANQRLLHTRDGFRNA 384

  Fly   381 EESPRYIVGAYLDWDIIYSRLRVLKKRLT 409
            .|..|.:.|.|.||||:.||:|.|:.:|:
 Worm   385 PEKARTLTGCYFDWDIVKSRVRFLRDKLS 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5321NP_001285244.1 DUF971 <48..113 CDD:294847 19/67 (28%)
carnitine_bodg 49..405 CDD:274118 121/374 (32%)
CAS_like 127..395 CDD:238154 93/284 (33%)
gbh-1NP_496305.1 DUF971 25..>50 CDD:294847 10/36 (28%)
carnitine_bodg 27..410 CDD:274118 123/399 (31%)
CAS_like 125..399 CDD:238154 91/279 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C275471026
eggNOG 1 0.900 E1_COG2175
Hieranoid 1 1.000
Homologene 1 1.000 H2967
Inparanoid 1 1.050 186 1.000 Inparanoid score I2568
Isobase 1 0.950 0.909372 Normalized mean entropy S3503
OMA 1 1.010
OrthoDB 1 1.010 D534559at33208
OrthoFinder 1 1.000 FOG0001127
OrthoInspector 1 1.000 T375182
orthoMCL 1 0.900 OOG5_129640
Panther 1 1.100 O PTHR10696
Phylome 1 0.910 0.870 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2023
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.