DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5321 and gbh-2

Sequence 1:NP_001285244.1 Gene:CG5321 FlyBaseID:FBgn0030575 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_495793.2 Gene:gbh-2 WormBaseID:WBGene00001523 Length:409 Species:Caenorhabditis elegans

Alignment Length:415 Identity:100/416 (24%)
Similarity:182/416 (44%) Gaps:57/416 (14%)


  Fly     2 WVPRLLGRSLSQLKTINSAQFSRQISAKIVNESSIEVQPEANSKPLTFPGIWLRDNCMCEDCFHG 66
            ||   .|.:|..:::.|..             ..|..:.|.|...|..|.:||||:|..:..:|.
 Worm    13 WV---TGWNLKNIRSKNDC-------------LEIRYENEGNPSKLIMPFVWLRDHCTSQKLYHL 61

  Fly    67 SSKSRKLDWDNFDTRIRPV----SLQTDEQSKEVLVKWSDAHESRFSL-KWLKERCFEPDKQQEY 126
            .:..||.:..:. |.:..:    .:..||.:..:.:.|.|.|:|:|.: ..::|...|.:...: 
 Worm    62 PTNQRKSNCCDI-TSLSKIKHSNQVIIDEATNSLQIVWIDGHQSKFKIGNIIREGKVEKNVSND- 124

  Fly   127 LRDFYRPTTRHWSGAEFQDIAQHFSYDEVMSQDSVLMQ-WLQALAIYGVALLRGAPLDEGVVRRL 190
             ...|    ..|:....:|:.:       :|:.::.:| :.:.|..|||.::.|.........:|
 Worm   125 -NKIY----ELWNSKSLKDVPR-------ISKSTLSLQSFSKNLVKYGVIIVDGVEGTSEATEKL 177

  Fly   191 ADRVGFIRRTTYGEEFV-----VQAKPGAQNFAYLSLTLPLHTDLPYYEYKPSVNILHCVVQTDS 250
            ...:..:..|.:|:.:|     ...:|..::.||.|..:..|||..|::..|.:.:.||:....:
 Worm   178 CQSLVPVHDTFFGQFWVFSNSATNDEPAYEDTAYGSDEIGPHTDGTYFDQTPGIQVFHCLTPAKT 242

  Fly   251 PGGSNMLVDGFHVADLLRRDHPEDFERLSRIVVDWNDI-GSEDGREFHNI-WRAPVICLDEEGRY 313
             ||..:|||.|:.|:.||.:.|||||.|....:..:.: ||..|...|:: ...|||..:..|..
 Worm   243 -GGDTVLVDSFYCAEKLRNESPEDFEILCNTKISHHYLEGSPPGSSIHSVSLEKPVIERNSFGNI 306

  Fly   314 TRINHSVPQRDSHFN------VPLEEVLPWYESYALFVRLAIADSHAFK--TRPGDVLTFNNIRL 370
            |:|..: |...:.|:      ....|.:.:||:|..|.::.....::.:  .|||.|:..:|.|:
 Worm   307 TQIRFN-PYDRAPFSCLNSSEASAAETIKFYEAYEKFSKICHNPDNSIEISLRPGSVIFIDNFRI 370

  Fly   371 LHGRTGYDDSEESPRYIVGAYLDWD 395
            ||.||.:    :..|.:.|.||..|
 Worm   371 LHSRTSF----QGYRQMCGCYLSRD 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5321NP_001285244.1 DUF971 <48..113 CDD:294847 17/70 (24%)
carnitine_bodg 49..405 CDD:274118 91/369 (25%)
CAS_like 127..395 CDD:238154 71/284 (25%)
gbh-2NP_495793.2 DUF971 22..104 CDD:294847 20/96 (21%)
carnitine_TMLD 43..402 CDD:274119 91/370 (25%)
CAS_like 129..391 CDD:238154 70/275 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2175
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D534559at33208
OrthoFinder 1 1.000 FOG0001127
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2023
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.