DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5321 and Tmlhe

DIOPT Version :9

Sequence 1:NP_001285244.1 Gene:CG5321 / 32399 FlyBaseID:FBgn0030575 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_038954324.1 Gene:Tmlhe / 170898 RGDID:620629 Length:445 Species:Rattus norvegicus


Alignment Length:316 Identity:92/316 - (29%)
Similarity:148/316 - (46%) Gaps:33/316 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 DAHESRFSLKWLKERCFEPDKQQEYLRDFYRPTTRHWSGAEFQDIAQHFSYD--EVMSQDSVLMQ 164
            |.|.:|:.|.||.:..:|..||     :..:|... |:...:|| ||..|.|  ..:.....|.:
  Rat   146 DGHVTRYDLDWLVKNSYEGQKQ-----EVIQPRVL-WNAKLYQD-AQLPSVDFQGFLETKEGLKK 203

  Fly   165 WLQALAIYGVALLRGAPLDEGVVRRLADRVGFIRRTTYGEEFVVQAKPGAQNFAYLSLTLPLHTD 229
            :||...:||:|.:...|..:....:||.||..||.|.||..:...:.....:.||..|.|..|||
  Rat   204 FLQNFLLYGIAFVENVPPTQEHTEKLARRVSLIRETIYGRMWYFTSDFSRGDTAYTKLALDRHTD 268

  Fly   230 LPYYEYKPSVNILHCVVQTDSPGGSNMLVDGFHVADLLRRDHPEDFERLSRIVVDWNDIGSEDGR 294
            ..|::....:.:.|| ::.:..||..:|||||:.|..:.:..||:|:.||::.:....|.:....
  Rat   269 TTYFQEPCGIQVFHC-LKHEGTGGRTLLVDGFYAAQQVLQRAPEEFDLLSQVPLKHEYIENVGQC 332

  Fly   295 EFHNIWRAPVICL---DEE---GRYTRINHSVPQRDSHFNVPLEEVLPWYESY-ALFVRLAIADS 352
            ..|.|...|::.:   ::|   .||...:.:|..     .||.:.|..||.:: .|...|...::
  Rat   333 HNHMIGVGPILNIYPWNKELYLIRYNNYDRAVIN-----TVPYDVVRRWYAAHRTLTTELRRPEN 392

  Fly   353 HAF-KTRPGDVLTFNNIRLLHGR---TGYDDSEESPRYIVGAYLDWDIIYSRLRVL 404
            ..: |.:||.||..:|.|:||||   |||       |.:.|.||..|.:.:..|:|
  Rat   393 ELWVKLKPGKVLFIDNWRVLHGRESFTGY-------RQLCGCYLTRDDVLNTARIL 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5321NP_001285244.1 DUF971 <48..113 CDD:294847 4/10 (40%)
carnitine_bodg 49..405 CDD:274118 92/316 (29%)
CAS_like 127..395 CDD:238154 80/280 (29%)
TmlheXP_038954324.1 CAS_like 145..443 CDD:412204 92/316 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2175
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D534559at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.