DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5321 and Tmlhe

Sequence 1:NP_001285244.1 Gene:CG5321 FlyBaseID:FBgn0030575 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_596878.2 Gene:Tmlhe RGDID:620629 Length:433 Species:Rattus norvegicus

Alignment Length:453 Identity:126/454 (28%)
Similarity:203/454 (45%) Gaps:73/454 (16%)


  Fly     1 MWVPRLL-----------------GRSLSQLKTINSAQFSR---QISAKIVN------ESSIEV- 38
            ||..:||                 |..||..|::  ..||.   ..::|.||      |..:|: 
  Rat     1 MWYHKLLHQQSRLQNLMKRGDIAHGLRLSGFKSL--FPFSLHWCHTASKSVNCTWHQHEDHLELG 63

  Fly    39 -QPEA--------NSKPLTFPGIWLRDNCMCEDCFHGSSKSRKLDWDNFDTRIRPVSLQTDEQSK 94
             :|.|        .|..:.|..:||||:|....|::..:..|.||..:.|..|:|.:::.||.: 
  Rat    64 TKPRALRLLELQYASTVMRFDYVWLRDHCRSASCYNSKTHQRSLDTASVDLCIKPKTIRLDEST- 127

  Fly    95 EVLVKWSDAHESRFSLKWLKERCFEPDKQQEYLRDFYRPTTRHWSGAEFQDIAQHFSYD--EVMS 157
             :...|.|.|.:|:.|.||.:..:|..||     :..:|... |:...:|| ||..|.|  ..:.
  Rat   128 -LFFTWPDGHVTRYDLDWLVKNSYEGQKQ-----EVIQPRVL-WNAKLYQD-AQLPSVDFQGFLE 184

  Fly   158 QDSVLMQWLQALAIYGVALLRGAPLDEGVVRRLADRVGFIRRTTYGEEFVVQAKPGAQNFAYLSL 222
            ....|.::||...:||:|.:...|..:....:||.||..||.|.||..:...:.....:.||..|
  Rat   185 TKEGLKKFLQNFLLYGIAFVENVPPTQEHTEKLARRVSLIRETIYGRMWYFTSDFSRGDTAYTKL 249

  Fly   223 TLPLHTDLPYYEYKPSVNILHCVVQTDSPGGSNMLVDGFHVADLLRRDHPEDFERLSRIVVDWND 287
            .|..|||..|::....:.:.|| ::.:..||..:|||||:.|..:.:..||:|:.||::.:....
  Rat   250 ALDRHTDTTYFQEPCGIQVFHC-LKHEGTGGRTLLVDGFYAAQQVLQRAPEEFDLLSQVPLKHEY 313

  Fly   288 IGSEDGREFHNIWRAPVICL---DEE---GRYTRINHSVPQRDSHFNVPLEEVLPWYESY-ALFV 345
            |.:......|.|...|::.:   ::|   .||...:.:|..     .||.:.|..||.:: .|..
  Rat   314 IENVGQCHNHMIGVGPILNIYPWNKELYLIRYNNYDRAVIN-----TVPYDVVRRWYAAHRTLTT 373

  Fly   346 RLAIADSHAF-KTRPGDVLTFNNIRLLHGR---TGYDDSEESPRYIVGAYLDWDIIYSRLRVL 404
            .|...::..: |.:||.||..:|.|:||||   |||       |.:.|.||..|.:.:..|:|
  Rat   374 ELRRPENELWVKLKPGKVLFIDNWRVLHGRESFTGY-------RQLCGCYLTRDDVLNTARIL 429

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5321NP_001285244.1 DUF971 <48..113 CDD:294847 21/65 (32%)
carnitine_bodg 49..405 CDD:274118 108/370 (29%)
CAS_like 127..395 CDD:238154 80/281 (28%)
TmlheNP_596878.2 DUF971 70..145 CDD:283749 22/77 (29%)
carnitine_TMLD 82..431 CDD:274119 108/371 (29%)
CAS_like 154..420 CDD:238154 82/286 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2175
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D534559at33208
OrthoFinder 1 1.000 FOG0001127
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.