DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5321 and Bbox1

Sequence 1:NP_001285244.1 Gene:CG5321 FlyBaseID:FBgn0030575 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_569719.1 Gene:Bbox1 MGIID:1891372 Length:387 Species:Mus musculus

Alignment Length:363 Identity:141/364 (39%)
Similarity:209/364 (57%) Gaps:9/364 (2%)


  Fly    49 FPGIWLRDNCMCEDCFHGSSKSRKLDWDNFDTRIRPVSLQTDEQSKEVLVKWSDAHESRFSLKWL 113
            :|.:||||||.|.||:..|:|:|||..:..|..||...|..|.  |:|.:.|.:.|.|.|...||
Mouse    29 YPAVWLRDNCQCSDCYLHSAKARKLLLEALDVNIRIDDLTFDR--KKVYITWPNDHYSEFEANWL 91

  Fly   114 KERCFEPDKQQEYLRDFYRPTTRHWSGAEFQDIAQHFSYDEVMSQDSVLMQWLQALAIYGVALLR 178
            |:|||....:.....:.:.|..::| |:|.|  ....::::|::.|....:||.:|...|:..|.
Mouse    92 KKRCFSQQARARLQGELFLPECQYW-GSELQ--LPTLNFEDVLNDDDHAYKWLSSLKKVGIVRLT 153

  Fly   179 GAPLDEGVVRRLADRVGFIRRTTYGEEFVVQAKPGAQNFAYLSLTLPLHTDLPYYEYKPSVNILH 243
            ||....|.:.:|..|:||:..|.||..:.||.|..|.|.||.:..|..|||.|...:.|.|.:||
Mouse   154 GAADKRGEIIKLGKRIGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLH 218

  Fly   244 CVVQTDSPGGSNMLVDGFHVADLLRRDHPEDFERLSRIVVDWNDIGSEDGREFHNIWRAPVICLD 308
            |:.||.: ||.:.:||||:|...|:..:|:.|..||...||:.||| .|..:|....:..:|.||
Mouse   219 CIKQTVT-GGDSEIVDGFNVCQKLKEKNPQAFHILSSTFVDFTDIG-VDYCDFSVQSKHKIIELD 281

  Fly   309 EEGRYTRINHSVPQRDSHFNVPLEEVLPWYESYALFVRLAIAD--SHAFKTRPGDVLTFNNIRLL 371
            ::|:..|:|.:...||:.|:||:|.|.|:|.:...||.|..:.  .:.||..||||:||:|.|||
Mouse   282 DKGQVVRVNFNNATRDTVFDVPIERVQPFYAALKEFVDLMNSKEYKYTFKMNPGDVITFDNWRLL 346

  Fly   372 HGRTGYDDSEESPRYIVGAYLDWDIIYSRLRVLKKRLT 409
            |||..|:...|..|::.|||.|||::.||||:|::|:|
Mouse   347 HGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVT 384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5321NP_001285244.1 DUF971 <48..113 CDD:294847 27/64 (42%)
carnitine_bodg 49..405 CDD:274118 139/358 (39%)
CAS_like 127..395 CDD:238154 101/270 (37%)
Bbox1NP_569719.1 DUF971 15..82 CDD:294847 23/55 (42%)
carnitine_bodg 16..381 CDD:274118 139/359 (39%)
CAS_like 107..370 CDD:238154 101/268 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C275473331
eggNOG 1 0.900 E1_COG2175
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H2967
Inparanoid 1 1.050 261 1.000 Inparanoid score I3069
Isobase 1 0.950 0.909372 Normalized mean entropy S3503
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001127
OrthoInspector 1 1.000 T616031
orthoMCL 1 0.900 OOG5_129640
Panther 1 1.100 O PTHR10696
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2023
TreeFam 1 0.960
1312.740

Return to query results.
Submit another query.