DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5321 and bbox1

Sequence 1:NP_001285244.1 Gene:CG5321 FlyBaseID:FBgn0030575 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001120574.1 Gene:bbox1 XenbaseID:XB-GENE-956892 Length:442 Species:Xenopus tropicalis

Alignment Length:418 Identity:161/419 (38%)
Similarity:233/419 (56%) Gaps:25/419 (6%)


  Fly     7 LGRSLSQL-KTINSAQF-SRQISAK----IVNESSIE------VQPEANSKPLTFPGIWLRDNCM 59
            |.|||.|. :..:||:| :.::.|.    |.|..|:|      |..|...:.: :|.:||||||.
 Frog    30 LSRSLLQFTRWQHSARFLAEELPASPLVMIRNVESLEKERFVCVHWEDGGQSV-YPFVWLRDNCQ 93

  Fly    60 CEDCFHGSSKSRKLDWDNFD--TRIRPVSLQTDEQSKEVLVKWSDAHESRFSLKWLKERCFEPDK 122
            |..||..|:|:|||..::.|  |.::.|:|   ..||:|.:.|.|.|:|.|..:|||:|||....
 Frog    94 CPQCFLHSAKARKLPIEDLDVNTGVKDVTL---TNSKKVSITWPDEHQSEFDGEWLKKRCFSKHA 155

  Fly   123 QQEYLRDFYRPTTRHWSGAEFQDIAQHFSYDEVMSQDSVLMQWLQALAIYGVALLRGAPLDEGVV 187
            :.|...:.:....::| |::.|  ....||::|::.|....|||.||...|:.||.|||:.:|.:
 Frog   156 RAEMQDELFASEHQYW-GSDLQ--IPTMSYEDVLNCDQTAYQWLCALRKVGIVLLEGAPVKQGEL 217

  Fly   188 RRLADRVGFIRRTTYGEEFVVQAKPGAQNFAYLSLTLPLHTDLPYYEYKPSVNILHCVVQTDSPG 252
            ..|..|:|::|.|.||..:.||.|..|.|.||.:..|.||||.|..:|.|.|..|||:.|..| |
 Frog   218 LSLGKRIGYMRLTFYGYTWQVQDKADANNVAYTAGKLSLHTDYPALQYPPGVQFLHCLKQAQS-G 281

  Fly   253 GSNMLVDGFHVADLLRRDHPEDFERLSRIVVDWNDIGSEDGREFHNIWRAPVICLDEEGRYTRIN 317
            |.:.:||||||...||..:||.|..|:...:|:.|.| .|..:|....:..:|.||.:|...|||
 Frog   282 GESEVVDGFHVCRKLREQNPEAFNILTSAQIDFTDTG-VDYCDFALQSKQRIIELDPKGNLLRIN 345

  Fly   318 HSVPQRDSHFNVPLEEVLPWYESYALFVRLAIADSHAF--KTRPGDVLTFNNIRLLHGRTGYDDS 380
            .:...|||..::|.:.|.|:|.|...||.|.....:.|  |.:||.|:||:|.|:||||..|...
 Frog   346 FNNATRDSVLDIPADRVQPFYSSLRAFVDLMNRPENTFSYKMQPGHVVTFDNWRILHGRRSYQSE 410

  Fly   381 EESPRYIVGAYLDWDIIYSRLRVLKKRL 408
            ....|::.|:|||||::.||:|.|||:|
 Frog   411 ATVSRHLEGSYLDWDVVLSRMRSLKKKL 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5321NP_001285244.1 DUF971 <48..113 CDD:294847 28/67 (42%)
carnitine_bodg 49..405 CDD:274118 143/360 (40%)
CAS_like 127..395 CDD:238154 104/270 (39%)
bbox1NP_001120574.1 DUF971 66..146 CDD:283749 31/84 (37%)
carnitine_bodg 71..435 CDD:274118 145/373 (39%)
CAS_like 162..425 CDD:238154 104/268 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C275472398
eggNOG 1 0.900 E1_COG2175
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H2967
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D534559at33208
OrthoFinder 1 1.000 FOG0001127
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.