DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5321 and tmlhe

Sequence 1:NP_001285244.1 Gene:CG5321 FlyBaseID:FBgn0030575 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_012823335.1 Gene:tmlhe XenbaseID:XB-GENE-978203 Length:435 Species:Xenopus tropicalis

Alignment Length:450 Identity:121/450 (27%)
Similarity:202/450 (45%) Gaps:79/450 (18%)


  Fly     1 MW---------VPRLLGRSLSQLKTINSAQFSRQISAK---------------IVNESSIEVQPE 41
            ||         |.|.|.|.:.:.:.:.|:...:.::|.               ::::..:||...
 Frog    15 MWCRRLACLYPVARALQRHVVRKQVLRSSISHKNVTAVHRWFSTAPDVKVCSWVLHKDHLEVLYS 79

  Fly    42 ANSKPLTFPGIWLRDNCMCEDCFHGSSKSRKLDWDNFDTRIRPVSLQTDEQSKEVLVKWSDAHES 106
            ...  :.|..:||||:|....|::..:..|.||....|..|:|..::.||.:  :.:.|.|.|.:
 Frog    80 GTC--MRFNYVWLRDHCRSASCYNAKTNQRSLDTATVDLDIQPALVRADETT--LYLTWPDGHMT 140

  Fly   107 RFSLKWLKERCFEPDKQQEYLRDFYRPTTRHWSGAEFQDI-AQHFSYDEVMSQDSVLMQWLQALA 170
            |:.|:||.:..:|..|||     ..:|... |:...:::. ....||.|.:.....|..:||...
 Frog   141 RYGLEWLVQNSYEGQKQQ-----LVQPRIL-WNERIYKEANVPSVSYSEFLKTSEGLRAFLQNFL 199

  Fly   171 IYGVALLRGAPLDEGVVRRLADRVGFIRRTTYGEEFVVQAKPGAQNFAYLSLTLPLHTDLPYYEY 235
            :||:|.:...|.......|:|:|:..||.|.||:.:.:.:.....:.||..|.|..|||..|::.
 Frog   200 LYGIAFVDDVPATYEDTERVAERISHIRETIYGKMWNLTSDFSRGDTAYTKLALDRHTDTTYFQE 264

  Fly   236 KPSVNILHCVVQTDSPGGSNMLVDGFHVADLLRRDHPEDFERLSRIVVDWNDIGSEDGREFHNIW 300
            ...:.:.|| ::.:..||..:|||||:.||.:|.|:|:|||.||.:.:....|.:..|...|.:.
 Frog   265 PCGMQLFHC-LRHEGTGGRTLLVDGFYAADQVRHDYPDDFELLSNVPLKHEYIENMAGSNNHMVG 328

  Fly   301 RAPVICL---DEE---GRYTRINHSVPQRDSHFNVPLEEVLPWYESY------------ALFVRL 347
            ..||:.:   ::|   .||...:.:|..     .||.:.|..||.::            .|:|:|
 Frog   329 IGPVLNVYPWNKELYMIRYNNYDRAVIS-----TVPYDIVQQWYIAHRRLTNELRRHENELWVKL 388

  Fly   348 AIADSHAFKTRPGDVLTFNNIRLLHGR---TGYDDSEESPRYIVGAYLDWDIIYSRLRVL 404
                      :||.||..:|.|:||||   |||       |.|.|.||..|.:.:..|:|
 Frog   389 ----------KPGKVLFVDNWRVLHGRESFTGY-------RQICGCYLTRDDVLNTSRLL 431

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5321NP_001285244.1 DUF971 <48..113 CDD:294847 21/65 (32%)
carnitine_bodg 49..405 CDD:274118 111/378 (29%)
CAS_like 127..395 CDD:238154 82/290 (28%)
tmlheXP_012823335.1 DUF971 69..147 CDD:294847 23/82 (28%)
carnitine_TMLD 84..433 CDD:274119 111/379 (29%)
CAS_like 156..422 CDD:238154 85/295 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2175
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D534559at33208
OrthoFinder 1 1.000 FOG0001127
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.