DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaNACtes4 and EGD1

DIOPT Version :10

Sequence 1:NP_572960.1 Gene:betaNACtes4 / 32389 FlyBaseID:FBgn0030566 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_015288.1 Gene:EGD1 / 856070 SGDID:S000005958 Length:157 Species:Saccharomyces cerevisiae


Alignment Length:66 Identity:18/66 - (27%)
Similarity:33/66 - (50%) Gaps:5/66 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KRQNMEEVVRIGGKGSMRRKHKRIPSVAAV--DEKRVQATLAKIPLKNISGIHELTIEFTDSSEV 67
            |.|.:....::|  |:.|:.:|:..|.|..  |:.::|:.|||:....|..:.|... |.|..:|
Yeast    10 KLQKLSANNKVG--GTRRKLNKKAGSSAGANKDDTKLQSQLAKLHAVTIDNVAEANF-FKDDGKV 71

  Fly    68 V 68
            :
Yeast    72 M 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaNACtes4NP_572960.1 NAC 5..>87 CDD:454759 18/66 (27%)
EGD1NP_015288.1 NAC_BTF3 9..125 CDD:409234 18/66 (27%)

Return to query results.
Submit another query.