DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaNACtes4 and Btf3

DIOPT Version :10

Sequence 1:NP_572960.1 Gene:betaNACtes4 / 32389 FlyBaseID:FBgn0030566 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_663430.2 Gene:Btf3 / 218490 MGIID:1202875 Length:204 Species:Mus musculus


Alignment Length:126 Identity:30/126 - (23%)
Similarity:43/126 - (34%) Gaps:38/126 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EHDIEGGDSYKRVKREFERLGSKWLGGTINYYYADNNNSVKEKVKSAIAYIANHTCIKFNEDPTH 91
            |..:|.||..:.::.|.|..|.:.|         .|:|..||                  ||.|.
Mouse    86 EEALEEGDEEEHLESEQEEKGKEEL---------KNSNKAKE------------------EDVTS 123

  Fly    92 --WQ--RLKIFTSELSHCRSTIGAP-GTRSGSAGELSMETGWCANIGSIVHEFSHSLGRYH 147
              |:  |..:|.      .|..|.| .||.|:...||...|....:.|.|.:..:.:...|
Mouse   124 ETWRSHRKHVFV------LSEAGKPIYTRYGTEEALSSIMGVMMLLMSFVEDKKNIIRSIH 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaNACtes4NP_572960.1 NAC 5..>87 CDD:454759 12/59 (20%)
Btf3NP_663430.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
NAC_BTF3 51..167 CDD:409234 28/113 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 168..190 1/11 (9%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.