DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dus2 and AT3G49645

DIOPT Version :10

Sequence 1:NP_572950.2 Gene:Dus2 / 32377 FlyBaseID:FBgn0030554 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001325799.1 Gene:AT3G49645 / 6241114 AraportID:AT3G49645 Length:241 Species:Arabidopsis thaliana


Alignment Length:128 Identity:28/128 - (21%)
Similarity:56/128 - (43%) Gaps:28/128 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FSLSES-RIRLVSIFGAG---------------LLVGTALSVIIPEGIEALYGAQCGAVHQHNHH 76
            ||.:|| ::|:..|.|.|               ..:..|:|....:.::.........||.::..
plant   617 FSEAESIKVRISLISGLGDNAYKWDASEMYLFRSSIAYAMSKYYSDVMKQEVSLTFENVHVYDET 681

  Fly    77 DHIN---PVVSPEGAIVNPAEAKQILENAKDKEDNLPRIIPKNAVLNEAIGRVVRSPP--ASP 134
            ..::   .|..|..|:|:..|.::.::.:||:.:::.: :..||:  |.||    .||  |:|
plant   682 PRVSFMFYVTMPNNAVVSKLEVEKAVKKSKDRINSIFK-LDDNAL--EFIG----IPPTLAAP 737

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dus2NP_572950.2 DUS_like_FMN 25..266 CDD:239200 28/128 (22%)
DSRM_DUS2L 394..458 CDD:380700
AT3G49645NP_001325799.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.