DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dus2 and T26G10.9

DIOPT Version :10

Sequence 1:NP_572950.2 Gene:Dus2 / 32377 FlyBaseID:FBgn0030554 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001254986.1 Gene:T26G10.9 / 13190789 WormBaseID:WBGene00206422 Length:83 Species:Caenorhabditis elegans


Alignment Length:73 Identity:22/73 - (30%)
Similarity:34/73 - (46%) Gaps:10/73 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 KYCVQSILRELQE-TPRGKRFLQCQTLQQICEIWELGDYCRRKQRELKTMGNSGRAEVEPPEALA 357
            ||.||.||...|| .||||..:...::.|||.       ....::||..:  ..|:|.:||....
 Worm     3 KYVVQRILGADQEYDPRGKATVAAGSVLQICR-------ASADRKELFVI--ISRSENQPPRRTV 58

  Fly   358 KRQKLEDA 365
            :.::..|:
 Worm    59 RNRRKRDS 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dus2NP_572950.2 DUS_like_FMN 25..266 CDD:239200
DSRM_DUS2L 394..458 CDD:380700
T26G10.9NP_001254986.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.