DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11674 and NimB4

Sequence 1:NP_572948.1 Gene:CG11674 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_788046.1 Gene:NimB4 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster

Alignment Length:324 Identity:76/325 (23%)
Similarity:110/325 (34%) Gaps:92/325 (28%)


  Fly    12 LAGFLATGRAEDLLELSCSS------D-AQCAQ------FERGRCV-DMACIC-TARGSGERVPC 61
            :.|..:|....:::|:.|..      | :||..      .|.|.|| ...|:| |......|..|
  Fly   109 IVGNSSTNPYMNVIEVCCKGWRRYEYDWSQCVPDCGERCQENGFCVAGGKCVCFTDFVLNYRNNC 173

  Fly    62 TPLEERLKLTNIIGGACPCPMPNAICHTRWQQCHCSEGHVSSDDRRRCLP---------AVVPVG 117
            .|             .||...|:..|:.. ..|.|.:|:.....|:.|.|         .|....
  Fly   174 VP-------------TCPLGCPHGRCYLN-GTCQCDKGYELDGSRKFCQPQCNATCGHNEVCLEP 224

  Fly   118 GSCEFQQQCQRADRFSSCIGNQCLCLNQFEFHEGRCLSVLQSSCLE-----------DKDC-GSC 170
            |.|...:...|..|.|:.:|.|.:|:....:  |.|:...:..|..           :.|| .:|
  Fly   225 GKCSCAEGYTRGLRESAALGCQPICIPDCGY--GHCVRPNECECFPGFQKRKNGITCEGDCYMTC 287

  Fly   171 GASICLTKTKRCGCSKNFVHNHNMTKCIKGSAYGDTCEHS---SP--CKLNLG---ADGRCLDHL 227
            ....|..|| .|.|...:.::.|.|.|:...  ||.|::.   ||  |:...|   ...|| :.:
  Fly   288 ENGFCANKT-TCVCQNGYRYDKNTTTCLPDC--GDNCDNGVCISPGNCRCFKGYVRNRERC-EAV 348

  Fly   228 CVCRSTHYPKRVANEVAKDENDDLDAVNNLERITCAPIVP----------FGALCRNDSECRMQ 281
            ||.....|.|.:|..|.                .|| |||          :| ||.....||.|
  Fly   349 CVGGCGFYGKCIAPNVC----------------GCA-IVPGPERTYQRCEYG-LCNAMGRCRCQ 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 15/66 (23%)
NimB4NP_788046.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.