DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXD10 and unpg

Sequence 1:NP_002139.2 Gene:HOXD10 HGNCID:5133 Length:340 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:371 Identity:89/372 (24%)
Similarity:146/372 (39%) Gaps:69/372 (19%)


Human     6 SSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMN 70
            |.|....|.::|||:     :...::|:...||...|......|...|   .|:..|....:|:.
  Fly    24 SKPFPKPFSIESLIA-----NQTPATATPPSPPEERDQEQEAEQEQEL---SARAMVASSALGLT 80

Human    71 VHP-YIPQVDSWTDPNR---------SCRI----------EQPVTQ---QVPTCSFTTNIKEES- 111
            ..| |.|.:..:...|.         .|.:          :||..|   |.|.....|:..|:. 
  Fly    81 QFPLYNPWLHGYFAQNHERLTHLIAGGCYLPSSPAGHPAAQQPQAQAQPQPPPPHPPTHALEKQL 145

Human   112 --NCCMYSDKR----NKLISAEVP---SYQRLVPESCPVENPEV--PVPGYFRLSQTYATGKTQE 165
              ......|.|    |...:...|   ||:||    ..:.|.:.  .:..:.||....|.|:..|
  Fly   146 PPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRL----AELMNQDYVHSLSVHARLQHMAAAGRMHE 206

Human   166 YNNSPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNEPV------SGQEPTKVSQVESPEAKGG 224
            ...:| |.:.:.....|:..:.|..|.:...||..::..:      ||...:.:|...||....|
  Fly   207 DQANP-GMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNG 270

Human   225 LPEERSCLAEVSVSSPEVQEKESKE-----------EIKSDTPTSNWLTAKSGRKKRCPYTKHQT 278
            ..::....|..:..|.:..:.|..:           :.:.:..:||   :|| |::|..:|..|.
  Fly   271 EMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSN---SKS-RRRRTAFTSEQL 331

Human   279 LELEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKM 324
            ||||:||....||:...|.:|:.|:.|::.||||||||||.|.|::
  Fly   332 LELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRV 377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXD10NP_002139.2 Homeobox 269..322 CDD:306543 26/53 (49%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.