DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12480 and prc

Sequence 1:NP_572937.1 Gene:CG12480 FlyBaseID:FBgn0030537 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_524658.2 Gene:prc FlyBaseID:FBgn0028573 Length:1713 Species:Drosophila melanogaster

Alignment Length:605 Identity:124/606 (20%)
Similarity:180/606 (30%) Gaps:178/606 (29%)


  Fly    58 GLAADGGYGLTALSSAP--SSSSSSSSEVVQGGDSSSYQYSKSAEVVPGGDASSYQPAEYTPAHL 120
            |:....|.|.....:.|  .......::...||.:.:.|....::...||...:.||        
  Fly  1002 GIGGQTGAGQPGYGAQPGFGGQLGYGNQPGVGGQTGAGQPGYGSQPGVGGQTGAGQP-------- 1058

  Fly   121 KSADVVP--------GGDSSSYQPAEYTPEHLRTVDVAPGVDSSSYQPAEYTPEHLKAAEVVPGG 177
             ...|:|        ||.:::.:|. |..:        ||:..|   |...|.:.......:.||
  Fly  1059 -GYGVIPGFGGQPGIGGQTAAGKPG-YGGQ--------PGIGGS---PVYGTQQGTGGQSGISGG 1110

  Fly   178 DSSSYQPAEYT-PEHLKAAE----VVP--GGDSSSYQPAEYTPAHLKAAVPAAIGADT------Y 229
                 ||...| |....|.:    .:|  ||.:::.||. |.|..     ...||..|      |
  Fly  1111 -----QPGYGTQPGQTGAGQPGYGSLPGTGGQATAGQPG-YGPGS-----QPGIGGQTVGGHGGY 1164

  Fly   230 APVPAAIGADTYTPEKFIPQDVQEAHYKYNQEQEQGAAVPGGDSSS----YQPAEY-----TPAY 285
            ...|...||..|..:                        |||...:    .||.:.     .|.|
  Fly  1165 GSQPGIGGAPVYGTQ------------------------PGGGGQTGVIGGQPGQIGDRVGQPGY 1205

  Fly   286 LKQTSSATVDAKVVPGGDSSSYQPAEYTPAHLKAAVPAAIGA------------DTYAPVPAAIG 338
            ..||.....              |..||..  ...||.|:|.            |.::...::||
  Fly  1206 GTQTGQIGA--------------PGRYTDG--SQTVPGAVGTGGVVAAGTSGADDAFSQAESSIG 1254

  Fly   339 ADTYTPEKFIPQDVQEAHYKYN----QEQEQGAAVPGGD-SSSYQPAEYTPEHLKAAEVVPGGDS 398
            ..         |....|..|.|    :.|..|....||. |:|...::  .:...:|:|....|.
  Fly  1255 DG---------QASASAQGKKNGGTAKTQVSGTYSSGGTFSASAMTSD--ADRAASAQVTGNADG 1308

  Fly   399 S-SYQPAEYTPAHLKASVPAAIGADTYAPVPAAIGADTYTPEKFIPQDVQEAHYKYIQEQEQEQG 462
            : |.......||..:|.|..|....|.|...:.         ..|.|...|.|       ..::|
  Fly  1309 AVSQSQGSGGPAQSQAQVQVAKDGGTKASSQSG---------GIIQQSQSEVH-------ANDKG 1357

  Fly   463 AAVPG-----GDSSSYQPAEYTPAQLKKSVVASTA--ASAISGADSSSYQSAVSQTSYVNSQAKT 520
            .....     |.:||.....:.|.|....:.|:..  ||:.||..||...|.:..||        
  Fly  1358 GLADAQSSGPGQTSSQAQIGFRPGQEANPIAANGGGQASSSSGTHSSQSSSQIHGTS-------- 1414

  Fly   521 IVAGSSSSSYQSAQPIAAYVQGQTPVVIGANTITPAHLYEEPTSNGIEEFNPDTHVPVAIGADTI 585
                |...||..|...|:..:.|......||    ..|:     |.|.:|..:.:. |...||.:
  Fly  1415 ----SFGVSYHGAAQSASGTKEQVATYREAN----RELF-----NTISQFGNNANA-VTDRADAV 1465

  Fly   586 TPAHLQASYSKSVQETQYAS 605
            .........|..|.|.|..|
  Fly  1466 YSGPALTDESDRVPEAQLKS 1485

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12480NP_572937.1 PHA03247 <112..395 CDD:223021 65/330 (20%)
prcNP_524658.2 Pericardin_rpt 159..191 CDD:284468
Pericardin_rpt 176..208 CDD:284468
Loricrin 216..534 CDD:292475
Pericardin_rpt 227..259 CDD:284468
Pericardin_rpt 244..276 CDD:284468
Pericardin_rpt 295..326 CDD:284468
Pericardin_rpt 312..344 CDD:284468
Pericardin_rpt 346..378 CDD:284468
Pericardin_rpt 363..395 CDD:284468
Pericardin_rpt 397..429 CDD:284468
Pericardin_rpt 431..463 CDD:284468
Pericardin_rpt 465..497 CDD:284468
Pericardin_rpt 482..514 CDD:284468
Pericardin_rpt 516..547 CDD:284468
Pericardin_rpt 533..565 CDD:284468
Pericardin_rpt 567..598 CDD:284468
Pericardin_rpt 584..616 CDD:284468
Pericardin_rpt 624..656 CDD:284468
Pericardin_rpt 641..673 CDD:284468
Pericardin_rpt 841..873 CDD:284468
Pericardin_rpt 893..929 CDD:284468
Glutenin_hmw 925..>1382 CDD:281191 93/479 (19%)
Pericardin_rpt 948..992 CDD:284468
Pericardin_rpt 977..1009 CDD:284468 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BNT3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.