DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12480 and frm

Sequence 1:NP_572937.1 Gene:CG12480 FlyBaseID:FBgn0030537 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001137887.1 Gene:frm FlyBaseID:FBgn0035612 Length:1180 Species:Drosophila melanogaster

Alignment Length:618 Identity:129/619 (21%)
Similarity:181/619 (29%) Gaps:187/619 (30%)


  Fly   103 PGGDASSYQPAEYTPAHLKSADVVPG-----GDSSSYQPAEYTPEHLRTVDVAPGVDSSSYQPAE 162
            |.|.....:|..:.|         ||     |.....:|..|.|..      .||....:.....
  Fly   564 PPGPKGPTKPGPFGP---------PGPPGPPGPPGPTRPGPYGPPG------PPGPTGPTRPGPP 613

  Fly   163 YTPEHLKAAEVVPGGDSSSYQPAEYTPEHLKAAEVVPGGDSSS---YQPAEYTPAHLKAAVPAAI 224
            ..|...:.....|.|.:....|....|.........|.|.|.:   |...| ||.:|....|..|
  Fly   614 GPPGPTRPGPPGPPGPTRPGPPGPTRPGPPGPTRPGPPGPSPNDPRYSDKE-TPGYLPPNQPGKI 677

  Fly   225 GADTYAPVPAAIGADTYTPEKFIPQDVQEAHYKYNQEQEQGAAVPGGDSSSYQPAEYTPAYLKQT 289
            .    .|.|:........|.|.:        ||.|.||....|:.....::..|..|.|.....|
  Fly   678 S----KPPPSYSQVIEIEPPKTV--------YKPNYEQNNDYAIKKPSVTTKPPLTYIPPSFPNT 730

  Fly   290 SSATVDAKV------------------VPG-------------------GDSSSY---QPAEYTP 314
            ....|.|.|                  ||.                   |:..::   .|...||
  Fly   731 PKPYVPAPVPAPQPPSQKITTTIVQPKVPAITIEKDKPNKSVTTPPVTTGNIENHTYLPPPPPTP 795

  Fly   315 AHL-KAAVPAAIGADTYAPVPAAIGADTYTPEKF------IPQDVQEAHYKYNQEQ-------EQ 365
            .:: |...|..|...|.||:|  |..:..||..|      :||      .:|:..|       :|
  Fly   796 KYVTKTKTPTPIPVPTPAPIP--IQYEPSTPRPFEKVVTKLPQ------IQYHTPQVPTVVVPKQ 852

  Fly   366 GAAVPGGDSSSYQPAEYTPEHLKAAEVVPG----------GDSSSYQPAEYTPAHLKASV----- 415
            ...||      |:|....|......:|.|.          .|.|....|:.|  |...|.     
  Fly   853 PVTVP------YKPVTRPPTVYVEPKVTPRPSPPLHVPSISDQSCVCNADKT--HSSKSTLTSTT 909

  Fly   416 ----------PAAI-------GADTYAPVPAAIGADTYTPEKFIPQDVQEAHYKYIQEQEQEQGA 463
                      ||::       |.:..|...:.|.|.:.|....|||                   
  Fly   910 TTTTTNSYPNPASVDFNKQFSGFNGQANFGSIINAMSLTQLPVIPQ------------------- 955

  Fly   464 AVPGGDSSSYQPAEYTPAQLKKSVVASTAASAISGAD--SSSYQSAVSQTSYVNSQAKTIVAGSS 526
             .||      |||.|.|.::.|..|.:.....|...:  |:..:::::|.:.::|....:..|.|
  Fly   956 -APG------QPAFYPPDKIPKGAVIALMPVVILPQEYYSNCEENSINQLTNIDSFPLGVQPGVS 1013

  Fly   527 SSSYQSAQPIAAYVQGQTPVVIGAN-----------TITPAHLYE---EPTSNGIEEFNPDTHV- 576
            .|.:......|...|...|.....|           |.|.|.|.|   ||.:...||..  |.| 
  Fly  1014 FSLHSVLTGSAPKDQCMCPCSCTQNLPNRLHKKREATDTEAPLEEKASEPVAAASEEVK--TLVE 1076

  Fly   577 PVAIGAD----TITPAHLQASYSKSVQETQYAS 605
            ||...|:    .:.|....:..||:..|...||
  Fly  1077 PVPAAAEEVKTLVEPVPAASEVSKAEVEPAAAS 1109

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12480NP_572937.1 PHA03247 <112..395 CDD:223021 71/345 (21%)
frmNP_001137887.1 Chitin_bind_4 54..102 CDD:278791
MttA_Hcf106 <1046..1128 CDD:294511 20/67 (30%)
L12 1051..1159 CDD:273301 19/62 (31%)
HHH_5 1092..>1168 CDD:304555 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BNT3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.