DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12480 and CG17104

Sequence 1:NP_572937.1 Gene:CG12480 FlyBaseID:FBgn0030537 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001260358.1 Gene:CG17104 FlyBaseID:FBgn0040496 Length:449 Species:Drosophila melanogaster

Alignment Length:397 Identity:76/398 (19%)
Similarity:140/398 (35%) Gaps:113/398 (28%)


  Fly   229 YAPVPAAIGADTYTPEKFIPQDVQEAHYKYNQEQEQGAAVPGGDSSSYQPAEYTPAYLKQTSSAT 293
            |:...||....|.:||....:||                    |||:|...|      :.|.:..
  Fly    14 YSHARAAPQKTTVSPEYEATEDV--------------------DSSTYMSVE------ESTITVD 52

  Fly   294 VDAKVV----PGGDSSSYQPAEYTPAHLKAAVPAAIGADTYAPVPAAI----------GADTYTP 344
            ||:.|:    |.|::.:    |.:|.           ..|..|:|.::          ..:...|
  Fly    53 VDSDVILTTNPEGEAFT----EASPI-----------VTTEEPLPDSVVQQLEMERAQEEELKNP 102

  Fly   345 EKFIPQDVQEAHYKYNQEQEQGAAVPGGDSSSYQPAEYTPEHLKAAEVVPGGDSSSYQPAEYTPA 409
            ||  |:|..::.   ::|::|..:     :|:.||         .:||.......||:....|..
  Fly   103 EK--PEDDLDSD---SEEEDQTTS-----TSTEQP---------KSEVSESTTKRSYKFGATTLP 148

  Fly   410 HLKASVPAAIGADTYAPVPAAIGADTYTPEKFIPQDVQEAHYKYIQE-----QEQEQGAAVPGGD 469
            ....:....:...|..|...|...:..|.|..:.::|:... .|.:.     :|.|...|....:
  Fly   149 PNFITTTRRVEITTILPQDGATTPNAETEETTVKEEVKTIR-NYFERKPAHMEEIELDMAENRME 212

  Fly   470 SSSYQPAEYTPAQLKKSVVASTAASAISGADSSSYQSAVSQTSYVNSQAKTIVAGSSSSSYQSAQ 534
            :::.:|..   ..::.|::.:|.|:.:         ....:|.....||:|:..        :..
  Fly   213 TTTNEPLH---ENVELSMIMTTDAALV---------EEDKKTGIETDQAETVET--------TVV 257

  Fly   535 PIAAYVQGQTPVVI----GANTITPAHLYEEPTSNG-IEEFNPDTHVPVAIGADTITPAHLQASY 594
            |:..||....|:|.    .:.|:.|....|..|:.| |||   .|.:|:.:.:     |....|.
  Fly   258 PVYQYVSNAAPIVTEPQPESTTVVPTVKEEAATTEGAIEE---TTELPLVLSS-----AFKPTSE 314

  Fly   595 SKSVQET 601
            ::...||
  Fly   315 AEETTET 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12480NP_572937.1 PHA03247 <112..395 CDD:223021 36/180 (20%)
CG17104NP_001260358.1 UPF0544 <86..139 CDD:292377 12/72 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BNT3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.