DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12480 and Muc11A

Sequence 1:NP_572937.1 Gene:CG12480 FlyBaseID:FBgn0030537 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001285150.1 Gene:Muc11A FlyBaseID:FBgn0052656 Length:1552 Species:Drosophila melanogaster

Alignment Length:548 Identity:141/549 (26%)
Similarity:195/549 (36%) Gaps:89/549 (16%)


  Fly    50 ADVSHLKLGLAADGGYGLTALSSAPSSSSS----SSSEVVQGGDSSSYQYSKSAEVVPGGDASSY 110
            |||:....|..|||.   :|...||:..||    |.::|......:....|.:|   ||..|...
  Fly   811 ADVTTAAPGAPADGS---SAAPGAPADGSSAAPGSPADVTTAAPGAPADGSSAA---PGAPADGS 869

  Fly   111 QPAEYTPAHLKSADVVPGGDSSSYQPAEYTPEHLRTVDVAPGVDSSSYQPAEYTPEHLKAAEVVP 175
            ..|..:||.:.:|  .||..:.....|..:|..:.|  .|||..:.....|..:|  .:.:...|
  Fly   870 SAAPGSPADVTTA--APGAPADGSSAAPGSPADVTT--AAPGAPADGSSAAPGSP--AEGSSAAP 928

  Fly   176 GGDSSSYQPAEYTPEHLKAAEVVPGGDSSSYQPAEYTPAHLKAAVPAAIGADTYAPVPAAIGADT 240
            |..:.....|...|  ...:...||..:.....|..:||.:..|.|.| .||..:..|.| .||.
  Fly   929 GAPADVTTAAPGAP--ADGSSAAPGAPADGSSAAPGSPADVTTAAPGA-PADGSSAAPGA-PADV 989

  Fly   241 YTPEKFIPQDVQEAHYKYNQEQEQGAAVPGGDSSSYQPAEYTPAYLKQTSSATVD-AKVVPGGDS 304
            .|.....|.|...|        ..|:...|..::...||:.|.|    ...|..| :...||..:
  Fly   990 TTAAPGAPADGSSA--------APGSPAEGSSAAPGAPADVTTA----APGAPADGSSAAPGAPA 1042

  Fly   305 SSYQPAEYTPAHLKAAVPAAIGADTYAPVPAAIGADTYTPEKFIPQDVQEAHYKYNQEQEQGAAV 369
            .....|..:||.:..|.|.| .||..:..|.: .||..|.....|.|             ..:|.
  Fly  1043 DGSSAAPGSPADVTTAAPGA-PADGSSAAPGS-PADVTTAAPGAPAD-------------GSSAA 1092

  Fly   370 PGGDSSSYQPAEYTPEHLKAAEVVP-GGD-SSSYQPAEYTPAHLKASVPAAIGADTYAPVPA-AI 431
            ||..:....||..:|    |...|| ||| :.|..||...||  .::|||. ||...:.||| ..
  Fly  1093 PGSPAEGSPPAGGSP----AGSNVPAGGDPADSNVPAGGAPA--DSNVPAG-GAPADSNVPAGGA 1150

  Fly   432 GADTYTPEKFIPQDVQEAHYKYIQEQEQEQGAAVPGG--DSSSYQPAEYTPAQLKKSVVASTAAS 494
            .||:..|....|.|..      :........:.||||  .:.:..||...||........:.|.|
  Fly  1151 PADSNVPAGGAPADAN------VPAGGAPADSNVPGGGAPADANVPAGGAPADSNVPAGGAPAGS 1209

  Fly   495 AI--SGADSSSYQSAVSQTSYVNSQA------KTIVAGSS-SSSYQSAQPIAAYVQGQTPVVIGA 550
            .:  .||.:.|...|....:..|..|      ..:.|||| .||.....|.|..|....||:.|.
  Fly  1210 NVPAGGAPADSNVPAGGAPADSNVPAGGAPAGSNVPAGSSPGSSVLGPNPPAGSVVPSIPVLPGG 1274

  Fly   551 NTITPAHLYEEPTSNGIEEFNPDTHVPV 578
            ....|.|              |..::|:
  Fly  1275 AGSWPWH--------------PRPNIPI 1288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12480NP_572937.1 PHA03247 <112..395 CDD:223021 69/285 (24%)
Muc11ANP_001285150.1 PRK07764 <366..816 CDD:236090 3/5 (60%)
PRK07764 <696..1109 CDD:236090 86/345 (25%)
CBM_14 1495..1547 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BNT3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.