DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12480 and FLG

Sequence 1:NP_572937.1 Gene:CG12480 FlyBaseID:FBgn0030537 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_002007.1 Gene:FLG HGNCID:3748 Length:4061 Species:Homo sapiens

Alignment Length:605 Identity:123/606 (20%)
Similarity:202/606 (33%) Gaps:151/606 (25%)


  Fly     7 RGNHRGQHSHH------PDLSQA----------------------HPFVHTHLIRLQKFYVIALA 43
            |..|.|.|..|      .|.|:.                      |.:.|.|....|        
Human  3456 RSGHSGSHHSHTTSQGRSDASRGQSGSRSASRQTRNDEQSGDGSRHSWSHHHEASTQ-------- 3512

  Fly    44 FVGLAAADVSHLKLGLAADGGYGLTALSSAPSSSSSSSSEVVQGGDS-----SSYQYSKSAEVVP 103
                  ||.|.     .:..|.|   .|:.|.:|.:..|.|.|..||     .|.::|.||....
Human  3513 ------ADSSR-----HSQSGQG---QSAGPRTSRNQGSSVSQDSDSQGHSEDSERWSGSASRNH 3563

  Fly   104 GGDA------SSYQPA---EYTPAHLKSADVVPGGDSSSYQPAEYTPEHLRTVDVAPGVDSSSYQ 159
            .|.|      .|..|.   |....|..||:       ||.|...:..|     :.:.|..:||::
Human  3564 RGSAQEQSRDGSRHPTSHHEDRAGHGHSAE-------SSRQSGTHHAE-----NSSGGQAASSHE 3616

  Fly   160 PAEYTPEHLKAAEVVPGGDSSSYQPAEYTPEHLKAAEVV--PGGDSSSYQPAEYTPAHLKAAVPA 222
            .|..:......:......|||.:...    .|.:|:..|  .|...||...|..:..|.:.:...
Human  3617 QARSSAGERHGSHHQQSADSSRHSGI----GHGQASSAVRDSGHRGSSGSQASDSEGHSEDSDTQ 3677

  Fly   223 AIGADTYAPVPAAIGADTYTPEKFIPQDVQEAHYKYNQEQEQG-AAVPGGDSSSYQPAEYTPAYL 286
            ::.|...|                      ..|.:.:||..:| :|...|.|.|:.   |..:..
Human  3678 SVSAHGQA----------------------GPHQQSHQESTRGRSAGRSGRSGSFL---YQVSTH 3717

  Fly   287 KQTSSATVDAKVVPGG-DSSSYQPAEYTPAHLKAAVPAAIGADTYAPVPAAIGA---DTYTPEKF 347
            :|:.||...|....|| ..|.::.|..:..|..:..    |.||....|.:...   .:|..:..
Human  3718 EQSESAHGRAGPSTGGRQGSRHEQARDSSRHSASQE----GQDTIRGHPGSRRGGRQGSYHEQSV 3778

  Fly   348 IPQDVQEAHYKYNQEQEQGAAVPGGDSSSYQPAEYTPEHLKAAEVVPGGDSSSYQPAEYTPA--- 409
            .......:|:.:...|.:..|..|...|.....|...|.       ..||.|.:..:.:..|   
Human  3779 DRSGHSGSHHSHTTSQGRSDASHGQSGSRSASRETRNEE-------QSGDGSRHSGSRHHEASTQ 3836

  Fly   410 -----HLKASVPAAIGADTYAPVPAAIGADTYTPEKFIPQDVQEA-------HYKYIQEQEQEQG 462
                 |.::....:.|:.......:::..|  :..:..|:|.:..       |:...:||.:: |
Human  3837 ADSSRHSQSGQGESAGSRRSRRQGSSVSQD--SDSEAYPEDSERRSESASRNHHGSSREQSRD-G 3898

  Fly   463 AAVPGGDSSSYQPAEYTPAQLKKSVVASTAASAISGADSSSYQSAVSQTSYVNSQAKTIVAGSSS 527
            :..||   ||::.   |.:.::.|.|.|.:    |.|....:.|::||.|..:|..::..:..||
Human  3899 SRHPG---SSHRD---TASHVQSSPVQSDS----STAKEHGHFSSLSQDSAYHSGIQSRGSPHSS 3953

  Fly   528 SSYQSAQPIAAYVQGQTPVV 547
            |||..........:||:.:|
Human  3954 SSYHYQSEGTERQKGQSGLV 3973

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12480NP_572937.1 PHA03247 <112..395 CDD:223021 56/293 (19%)
FLGNP_002007.1 S-100 2..88 CDD:238131
Filaggrin 1 258..306
Filaggrin 2 374..428
Filaggrin 388..428 CDD:281510
Filaggrin 3 579..630
Filaggrin 4 698..753
Filaggrin 712..753 CDD:281510
Filaggrin 5 904..955
Filaggrin 915..955 CDD:281510
Filaggrin 6 1023..1077
Filaggrin 1036..1077 CDD:281510
Filaggrin 7 1228..1279
Filaggrin 1239..1279 CDD:281510
Filaggrin 8 1347..1401
Filaggrin 1360..1401 CDD:281510
Filaggrin 9 1552..1603
Filaggrin 1563..1603 CDD:281510
Filaggrin 10 1671..1725
Filaggrin 1684..1725 CDD:281510
Filaggrin 11 1876..1927
Filaggrin 12 1995..2050
Filaggrin 2009..2050 CDD:281510
Filaggrin 13 2201..2252
Filaggrin 2212..2252 CDD:281510
Filaggrin 14 2320..2374
Filaggrin 2333..2374 CDD:281510
Filaggrin 15 2525..2576
Filaggrin 16 2644..2698
Filaggrin 2657..2698 CDD:281510
Filaggrin 17 2849..2900
Filaggrin 18 2968..3022
Filaggrin 2981..3022 CDD:281510
Filaggrin 19 3173..3224
Filaggrin 20 3292..3346
Filaggrin 3305..3346 CDD:281510
Filaggrin 21 3497..3548 17/73 (23%)
Filaggrin 22 3616..3670 11/58 (19%)
Filaggrin 3629..3670 CDD:281510 10/45 (22%)
Filaggrin 23 3821..3872 6/53 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BNT3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.