DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12480 and C50F7.5

Sequence 1:NP_572937.1 Gene:CG12480 FlyBaseID:FBgn0030537 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_501263.2 Gene:C50F7.5 WormBaseID:WBGene00016845 Length:306 Species:Caenorhabditis elegans

Alignment Length:378 Identity:80/379 (21%)
Similarity:106/379 (28%) Gaps:115/379 (30%)


  Fly     7 RGNHRGQHSHHPDLSQAHPFVHTHLIRLQKFYVIALAFVGLAAADVSHLKLGLAADGGYGLTALS 71
            ||:|...|.||          .|...|..:                             |:...:
 Worm    24 RGHHHHHHHHH----------KTKAPRTSR-----------------------------GIATTT 49

  Fly    72 SAPSSS------SSSSSEVVQGGD---SSSYQYSKSAEVVPGGDASSYQPAEYTPAHLKSADVVP 127
            .||:||      |||:..:....|   .:|.....|.|..||..|.|.:|:...|..       |
 Worm    50 FAPTSSDLPIAGSSSAPVIASSADPILPTSVVPQPSNEPSPGTVAPSDEPSPSGPPS-------P 107

  Fly   128 GGDSSSYQPAEYTPEHLRTVDVAPGVD-SSSYQPAEYTPEHLKAAEVVPGGDSSSYQPAEYTPEH 191
            |..:.|..|....|.....||  |..| ..|.:|:|   :|..:....||....|..|   .|..
 Worm   108 GPVNPSEDPQPSGPPSPGPVD--PSEDPQPSVEPSE---DHQPSGPPSPGPVDPSEDP---QPSV 164

  Fly   192 LKAAEVVPGGDSSSYQPAEYTPAHLKAAVPAAIGADTYAPVPAAIGADTYTPEKFIPQDVQEAHY 256
            ..:.:..|.|..|   |....|:.    .|...|:.:..||.              |.|      
 Worm   165 EPSEDPQPSGPPS---PGPVDPSE----DPQPSGSSSPGPVD--------------PSD------ 202

  Fly   257 KYNQEQEQGAAVPGGDSSSYQPAEYTPAYLKQTSSATVDAKVVPGGDSSSYQPAEYTPAHLKAAV 321
               :....|...||....|..|....|     .|...||....|........|....|...:.  
 Worm   203 ---EPSPSGPPSPGPVDPSEDPKPSEP-----PSPGPVDPSDEPSPSDPPGPPGPPGPPTRRP-- 257

  Fly   322 PAAIGADTYAPVPAAIGADTYTPEKFIP---------QDVQEAHYKYNQEQEQ 365
            |...|..|..| |...|..|..|    |         ......|:.::.:|||
 Worm   258 PGPPGPPTRRP-PGPPGPPTRRP----PGPPGPPHHHDHGHHGHHGHHFDQEQ 305

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12480NP_572937.1 PHA03247 <112..395 CDD:223021 56/265 (21%)
C50F7.5NP_501263.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BNT3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.