DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mamo and BtbVII

Sequence 1:NP_572932.2 Gene:mamo FlyBaseID:FBgn0267033 Length:1553 Species:Drosophila melanogaster
Sequence 2:NP_647774.2 Gene:BtbVII FlyBaseID:FBgn0263108 Length:907 Species:Drosophila melanogaster

Alignment Length:1500 Identity:310/1500 (21%)
Similarity:463/1500 (31%) Gaps:688/1500 (46%)


  Fly     1 MGSEHYCLRWNNYQSNLLGVFSQLLQDGSLVDVTLVCSEGTSIRAHKVVLSACSSYFQSLFLEHP 65
            |..:.:||||||:|.|.:.|.|.||.:|:|||||| .:||..::|||:||||||||||:||..:|
  Fly     1 MSVQQFCLRWNNHQPNFISVCSSLLHNGTLVDVTL-AAEGRQLQAHKIVLSACSSYFQALFTTNP 64

  Fly    66 EGHLIVILKDVRFAELQTLVEFMYKGEVNVQYCQLSALLKTAESLKVKGLAEMTNQ--NTTLREP 128
            ..|.|||||||::.:|:|:|:|||.|||||...||..:|||||.||:||||||...  |.|..:.
  Fly    65 CQHPIVILKDVQYDDLKTMVDFMYYGEVNVSQEQLPHILKTAEMLKIKGLAEMPTDPANLTKSDS 129

  Fly   129 EREPDRLRPQGGGGSGGSAHKAADSPAAALDATAATQAATATATATAAAATSTSTSATSAAATAA 193
            :...|.....||.|.|                                                 
  Fly   130 KSSTDGTEMVGGAGVG------------------------------------------------- 145

  Fly   194 ATAATSASTTATAAAGSSNTTTTTAATTTATCATAATSTAATSSSSSVTSAAAAAAAAASASGVA 258
                                                            |.|..:|.:..:.||.:
  Fly   146 ------------------------------------------------TGAGNSAGSLGAGSGSS 162

  Fly   259 HSEEATSSSSSTGGQKREASDRSSPTPAKRSSRMHPADKVDVAEDREQEQNQADELLSEELLGRN 323
            ..:...|||                               :..:.::|:|.||.:          
  Fly   163 VGDSLWSSS-------------------------------EAQQFQQQQQQQAQQ---------- 186

  Fly   324 LKDEEDDDVDELDENEETKLRGRDEDDDDEDEEEDTPMPLDLYQRPNVEPKSAAAATAAQQGGSN 388
                                                                    .|.||    
  Fly   187 --------------------------------------------------------QAQQQ---- 191

  Fly   389 SLSGSSNACHTNSSSNSNNNNNNNNNSSSNNNNNTSSGKTSASSNGGTASSGGTADSVVAVDDDD 453
                     |                                                       
  Fly   192 ---------H------------------------------------------------------- 192

  Fly   454 DDDDGGHHHQRQVMDDRLEQDVDEEDLDDDVVVVGPATAMARGIAQRLAHQNLQRLHHTHHHAQH 518
                  ||||:|   .:|:|.                       .|:...|..|:.||.|||.|.
  Fly   193 ------HHHQQQ---QQLQQQ-----------------------QQQAQQQQQQQQHHHHHHQQQ 225

  Fly   519 QHSQHHHPHSQHHHTPHHQQHHTHSD-DEDAMPVIAKSEILDDDYDDEMDLEDDDEADNSSNDLG 582
            |..|     :|...|.|||...|.|. .....|...:..:.....:...|..:.:|..|||.|.|
  Fly   226 QSGQ-----AQAAQTHHHQMRRTPSPLSAGTSPATRRKRLRKSSNNGSGDRNNAEEQHNSSLDAG 285

  Fly   583 LNMKMGSGGA------------GGGGGVDLSTGSTLIPSPLITLPSSSAAAAAAAAAAMESQRST 635
                .|:|.|            |.|||:   .|.:|..:.|:         ..:|:|.:|.|...
  Fly   286 ----SGAGNAGLSLAQMNQMTFGAGGGL---AGHSLHAAKLL---------KESASAELEQQPQD 334

  Fly   636 PAMSAAQAAGAGASDLSIGGCGGRPASRSSRDGGGN-------DGGRGGASSSSLLSPGTVANLL 693
                         |||.              ||.|:       :...||.:              
  Fly   335 -------------SDLD--------------DGHGHLHMQIKPEVDIGGVN-------------- 358

  Fly   694 PVQSVPLSLKKEIDCSEDD----NSSHSR----------HMQQRSASAGGGLGGDLDYRASHESL 744
              |::||.:......||.|    .||||.          |....:||:..|..|..:        
  Fly   359 --QTMPLDISGGTTPSEHDAPNSQSSHSEPSPAHAPHPPHPPLGAASSSSGGSGSFE-------- 413

  Fly   745 LRNFSSPMSAMAASRCPTPFAFPFSPLGLSLFDIDPSRILSLLHHQTWLAEEALRTRGLLTAPKD 809
             |:||  :..:.:..| .|...|.||..:.                                   
  Fly   414 -RSFS--IGGVGSVEC-DPDGTPSSPAVMG----------------------------------- 439

  Fly   810 FPHRFTTLSDLLTKDYQPGAGQPMVTATATATTASSTSQVSASRSGDTQYNKHAQQPQQPQTGGA 874
                 |..:.:||:       ||.|  ...:.:.|||:|:|                  |.|...
  Fly   440 -----TKRNRVLTR-------QPRV--KRDSDSISSTNQIS------------------PDTAAT 472

  Fly   875 TGSGVGGLGGSP--TAGA-SFNLRYPTPTAFYQQQQQQG--------------KGAKSSPSPQQM 922
            |      |...|  .||| |...|..:.|..:....|..              :...|.|:| .:
  Fly   473 T------LDFDPFNAAGATSATARDYSTTGSHHLHHQSAVHHHHHLLTVPPRIERHASEPAP-SL 530

  Fly   923 ATSSTTVMSNDSGEDSCKRSSADSDEVTIMELPSERSAQLYKESLEQLLQRQRRTPILAGSGSGS 987
            |.|:..::|                      :||. :..|.|:..:.||.||.... :|||||||
  Fly   531 APSTPHLLS----------------------VPSS-TPYLIKQHSDPLLPRQSALH-MAGSGSGS 571

  Fly   988 GSGTGSGSVIVDAAGL-RQYTQLLLAGAGSGGA----------SDLKEKSSSSSTSSTPPLLTQQ 1041
            .|...:||  ...|.| |||:..|   :||..:          ..:....|..::.|.||..:.|
  Fly   572 SSAMATGS--NPFAPLHRQYSHPL---SGSNASYVTPAPLHHPHHISLPESIYASGSPPPAGSSQ 631

  Fly  1042 L---SQMLKSP---SDTCSSLFSSSGGGTGSTGPGITGETIEEETRCVVCNAHFPNVWLLEQHAA 1100
            .   ::::..|   |:|.::..::|.|.:.:....::          ||.:   ||..|  |::|
  Fly   632 YLVPTRVVACPVVSSETAATPTNASPGSSSTVSAAVS----------VVTS---PNAGL--QNSA 681

  Fly  1101 LQHPHVGPGEEKPFICEQCGQSYRYRSAYAKHKEQNHRARLPADKLFTCDVCGMQFRYLKSFKKH 1165
            .:|| :.|             ::...|..|..:...|...:...::                   
  Fly   682 SRHP-LSP-------------TFSIGSDVAHERRSPHSPSISRSQV------------------- 713

  Fly  1166 RLNHALERLHGKKSVGVIGRLGGSGSGPSSSAISVSVAAPTSVSASGSVTSV----DQDVVTSSQ 1226
                 :||               :|..|:.:|........||.|||||:|..    .|..::||.
  Fly   714 -----VER---------------AGKNPAEAANGGGSRLRTSKSASGSITGTHLHPGQATMSSSF 758

  Fly  1227 E--PMLADEGEDLRVNVKREGTADEQSAESRANDLEEHEQDNTVDSAGITMLYQDNNSSASASTS 1289
            |  |.|..:.|:|:.:|....|..|                         ::..:|..|:.....
  Fly   759 EHLPTLRVKNEELQRSVSSPQTQRE-------------------------IITLENPRSSHCPVI 798

  Fly  1290 ATEPNISSSDGIHSTNKRSRLHHLETDPSYPHHHHHHHHHHHQQQHHQAQHQHHNPQSQLPTHL- 1353
            ...|.:..:...::.:...|:...:|                         ::|.|:.|  |:| 
  Fly   799 RPGPALGCNFCWNTIDGHGRILRRKT-------------------------KYHCPECQ--TNLC 836

  Fly  1354 -------GHVSLPLVATSAAGSSSSAAAAAVVAAAQAQVSSGATGSGATGSGAPGSGNVGSAGSS 1411
                   .|..|         ::.:|||::..||...|:||..||||::.|| ..|..|.|||||
  Fly   837 IVPCFQEYHERL---------NNEAAAASSGAAAGDNQLSSSTTGSGSSSSG-KASPYVSSAGSS 891

  Fly  1412 GAGGG 1416
            .:|.|
  Fly   892 SSGAG 896

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mamoNP_572932.2 BTB 21..118 CDD:279045 61/97 (63%)
BTB 32..118 CDD:197585 55/86 (64%)
C2H2 Zn finger 1082..1105 CDD:275368 9/23 (39%)
C2H2 Zn finger 1116..1137 CDD:275368 2/21 (10%)
C2H2 Zn finger 1149..1169 CDD:275368 0/20 (0%)
zf-C2H2 1469..1491 CDD:278523
C2H2 Zn finger 1471..1491 CDD:275368
zf-H2C2_2 1483..1506 CDD:290200
C2H2 Zn finger 1499..1519 CDD:275368
zf-H2C2_2 1511..1536 CDD:290200
C2H2 Zn finger 1527..1547 CDD:275368
BtbVIINP_647774.2 BTB 24..117 CDD:279045 60/94 (64%)
BTB 32..117 CDD:197585 55/86 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000318
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23110
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.