DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and eEF1gamma

DIOPT Version :10

Sequence 1:NP_572928.1 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_652000.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster


Alignment Length:190 Identity:38/190 - (20%)
Similarity:75/190 - (39%) Gaps:42/190 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FEATHPPILID-NGLA-ILENEKIERHIMKNIPGGYNLFVQ----------DKE-VATLIENLYV 130
            ||......|.: |.:| :|.||::.        ||...|||          |.| |......::.
  Fly    58 FETAEGQYLSESNAIAYLLANE
QLR--------GGKCPFVQAQVQQWISFADNEIVPASCAWVFP 114

  Fly   131 KLKLMLVKKDEAKNNALLSHLRKINDHLSARNTRFLTGDTMCCFDCELMPRLQHIRVAGKYFVDF 195
            .|.::..:|:........:.|:::|..|  ::..||.|:.:...|..:...|.|:.   :|.::.
  Fly   115 LLGILPQQKNSTAKQEAEAVLQQLNQKL--QDATFLAGERITLADIVVFSSLLHLY---EYVLEP 174

  Fly   196 EIPTHLTALWRY---MYHMYQLDAFTQSCPADQDIINHYKLQQSLKM---KKHEELETPT 249
            .:.:....:.|:   :.:..|:.|          ::..|||.:...:   ||:.|.:..|
  Fly   175 SVRSAFGNVNRWFVTILNQKQVQA----------VVKDYKLCEKALVFDPKKYAEFQAKT 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_572928.1 GST_N_CLIC 18..112 CDD:239359 9/34 (26%)
GST_C_CLIC 118..232 CDD:198307 18/117 (15%)
eEF1gammaNP_652000.1 GST_N_EF1Bgamma 4..79 CDD:239342 6/20 (30%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 22/133 (17%)
EF1G 273..376 CDD:459888
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.