DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and YJR142W

DIOPT Version :8

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_012676.3 Gene:YJR142W / 853607 SGDID:S000003903 Length:342 Species:Saccharomyces cerevisiae

Alignment Length:128 Identity:21/129 (16%)
Similarity:40/129 (31%) Gaps:34/129 (26%)


  Fly    90 LCQERGTNEISLLYTRRSRHLRSHSFQISFPGGRRDDHDSSYVDCALRETEEEIGLP------RH 148
            :|.|.......|..:|.....:|..|          ||.::.:|...|:...|..|.      ..
Yeast    75 VCSEIFEETFQLDESRHELRFKSEDF----------DHRNNLIDQLARKMYLESSLSGVKGWRNE 129

  Fly   149 RIQVWGEAKQLQLPRTSSIVPVVGVVPDFSLSELRLNWEEVEEAFSVPLTSLMLPKATRHTQF 211
            :..||...|...|.. .::..|:|::                 .:.:.:...:|...::..||
Yeast   130 KYAVWVNKKPYVLVE-RAVAGVLGII-----------------TYGIHINGYVLDPKSKKVQF 174

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 CoAse 84..238 CDD:239518 21/129 (16%)
YJR142WNP_012676.3 DUF4743 57..153 CDD:330603 18/89 (20%)
Nudix_hydrolase_3 125..315 CDD:239648 9/69 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.