DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and NUDT8

DIOPT Version :8

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001230679.1 Gene:NUDT8 / 254552 HGNCID:8055 Length:236 Species:Homo sapiens

Alignment Length:212 Identity:74/213 (35%)
Similarity:104/213 (49%) Gaps:29/213 (14%)


  Fly    50 LGPESQRRCME-------KMRSLPAFPRPKALTPSRREKQTSAVLIALCQERGTNEISLLYTRRS 107
            |..|.:.||..       ::|:.||               ::|||:.||..||..  :||||.||
Human     6 LSAEGELRCRRLLAGATARLRARPA---------------SAAVLVPLCSVRGVP--ALLYTLRS 53

  Fly   108 RHLRS-HSFQISFPGGRRDDHDSSYVDCALRETEEEIGLPRHRIQVWGEAKQLQLPRTSSIVPVV 171
            ..|.. |...:|||||:.|..|...|..|||||.||:||......|||..:.:..|:.:::|||:
Human    54 SRLTGRHKGDVSFPGGKCDPADQDVVHTALRETREELGLAVPEEHVWGLLRPVYDPQKATVVPVL 118

  Fly   172 GVVPDFSLSELRLNWEEVEEAFSVPLTSLMLPKATRHTQFRSG----YSGPVFVVDHYRIWGITG 232
            ..|.......||.|.|||:|.|::||..|:..:...:|.|..|    |:.|||:...:|:||:|.
Human   119 AGVGPLDPQSLRPNSEEVDEVFALPLAHLLQTQNQGYTHFCRGGHFRYTLPVFLHGPHRVWGLTA 183

  Fly   233 YLTHLFLHCLLPPNLLP 249
            .:|...|..|.|....|
Human   184 VITEFALQLLAPGTYQP 200

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 CoAse 84..238 CDD:239518 63/159 (40%)
NUDT8NP_001230679.1 CoAse 32..186 CDD:239518 62/156 (40%)
Nudix box 70..91 10/21 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0494
Hieranoid 1 1.000
Homologene 1 1.000 H41633
Inparanoid 1 1.050 111 1.000 Inparanoid score I4795
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1253012at2759
OrthoFinder 1 1.000 FOG0001410
OrthoInspector 1 1.000 T1075143
orthoMCL 1 0.900 OOG5_127325
Panther 1 1.100 LDO PTHR12992
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1771
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.