DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and NUDT10

DIOPT Version :8

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001291892.1 Gene:NUDT10 / 170685 HGNCID:17621 Length:164 Species:Homo sapiens

Alignment Length:88 Identity:23/89 (26%)
Similarity:39/89 (44%) Gaps:19/89 (21%)


  Fly   120 PGGRRDDHDSSYVDCALRETEEEIGLPRHRIQVWGEAKQLQLPRTSSIVPVVGVVPDFSLSELRL 184
            |||..:..:.. ...|:||..||.|:.....::.|..:|.|.|:..:.|.|:      :::||..
Human    48 PGGGMEPEEEP-GGAAVREVYEEAGVKGKLGRLLGVFEQNQDPKHRTYVYVL------TVTELLE 105

  Fly   185 NWEE------------VEEAFSV 195
            :||:            ||:|..|
Human   106 DWEDSVSIGRKREWFKVEDAIKV 128

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 CoAse 84..238 CDD:239518 23/89 (26%)
NUDT10NP_001291892.1 Substrate binding. {ECO:0000250|UniProtKB:O95989} 17..19
Nudix_Hydrolase_9 18..137 CDD:240024 23/89 (26%)
Substrate binding. {ECO:0000250|UniProtKB:O95989} 38..40
Nudix box 50..71 6/22 (27%)
Substrate binding. {ECO:0000250|UniProtKB:O95989} 89..91 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.