DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and cpr-6

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_741818.1 Gene:cpr-6 / 180931 WormBaseID:WBGene00000786 Length:379 Species:Caenorhabditis elegans


Alignment Length:336 Identity:168/336 - (50%)
Similarity:211/336 - (62%) Gaps:21/336 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LTSGEPSLLSDEFIEVVRSKAKTWTV--GRNFDASVTEGHIRR--LMGVHPDAHKFALPDKREVL 76
            :.|....|..|:.|:.|......||.  .|.|.:...|....:  ||||:   |.     :..|.
 Worm    34 IDSEAAELDGDDLIDYVNENQNLWTAKKQRRFSSVYGENDKAKWGLMGVN---HV-----RLSVK 90

  Fly    77 GDLYVNSVDEL----PEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVN 137
            |..:::...:|    ||.||||..||.|.:|..||||.|||||||||||||||||:||.|.|::.
 Worm    91 GKQHLSKTKDLDLDIPESFDSRDNWPKCDSIKVIRDQSSCGSCWAFGAVEAMSDRICIASHGELQ 155

  Fly   138 FHFSADDLVSCCHTCGFGCNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTR- 201
            ...|||||:|||.:||||||||.|.|||.||.:.|||:|..|.:|.||:||...|||||...|. 
 Worm   156 VTLSADDLLSCCKSCGFGCNGGDPLAAWRYWVKDGIVTGSNYTANNGCKPYPFPPCEHHSKKTHF 220

  Fly   202 PPCAHG-GRTPKCSHVCQSGYT-VDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYED 264
            .||.|. ..||||...|.|.|| ..|::||.||:.:|.|:.:|..||:|:||:||:|.||.||||
 Worm   221 DPCPHDLYPTPKCEKKCVSDYTDKTYSEDKFFGASAYGVKDDVEAIQKELMTHGPLEIAFEVYED 285

  Fly   265 LILYKDGVYQHEHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDHCGI 329
            .:.|..|||.|..||..||||::::|||:  ::.||||.:.||||||||:.||||||||.|.|||
 Worm   286 FLNYDGGVYVHTGGKLGGGHAVKLIGWGI--DDGIPYWTVANSWNTDWGEDGFFRILRGVDECGI 348

  Fly   330 ESSISAGLPKL 340
            ||.:..|:|||
 Worm   349 ESGVVGGIPKL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 12/43 (28%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 146/250 (58%)
cpr-6NP_741818.1 Propeptide_C1 44..82 CDD:369701 10/37 (27%)
Peptidase_C1A_CathepsinB 106..355 CDD:239111 146/250 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 320 1.000 Domainoid score I663
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 331 1.000 Inparanoid score I1432
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D439739at33208
OrthoFinder 1 1.000 - - FOG0001215
OrthoInspector 1 1.000 - - otm14118
orthoMCL 1 0.900 - - OOG6_101151
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1059
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.