DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXD8 and unpg

Sequence 1:NP_062458.1 Gene:HOXD8 HGNCID:5139 Length:290 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:287 Identity:74/288 (26%)
Similarity:94/288 (33%) Gaps:110/288 (38%)


Human    56 NSAAGFPHA-PPQAHAHPHPSPP---------------------------PSGTGCGG------- 85
            :|.||.|.| .|||.|.|.|.||                           |:..|...       
  Fly   112 SSPAGHPAAQQPQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRR 176

Human    86 -REGRGQEYFH-----------------------PGGGSPAAAYQAAPPPPPHPPP-------PP 119
             .|...|:|.|                       ||    .|..|...||..|..|       |.
  Fly   177 LAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPG----MAQLQEPTPPQAHSSPAKSGSHSPM 237

Human   120 PPP---------PCGGIACHG-----EPAKFYGYDNLQRQPIFTTQQEAELVQYPDC-------- 162
            .|.         .|.|.:|..     .|..:.|..:..|...:|....      .||        
  Fly   238 EPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDS------EDCSDDEGAQS 296

Human   163 KSSSGNIGEDPDHLNQSSSPSQMFPWMRPQAAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRR 227
            :...|.:|......|.|||.|:            .||.|..::..|.||||:||....||:...|
  Fly   297 RHEGGGMGGKDSQGNGSSSNSK------------SRRRRTAFTSEQLLELEREFHAKKYLSLTER 349

Human   228 IEVSHALALTERQVKIWFQNRRMKWKK 254
            .:::.:|.|:|.||||||||||.|||:
  Fly   350 SQIATSLKLSEVQVKIWFQNRRAKWKR 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXD8NP_062458.1 Homeobox 201..253 CDD:278475 26/52 (50%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.