DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12177 and URH1

Sequence 1:NP_001285222.1 Gene:CG12177 FlyBaseID:FBgn0030510 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_010688.4 Gene:URH1 SGDID:S000002808 Length:340 Species:Saccharomyces cerevisiae

Alignment Length:362 Identity:95/363 (26%)
Similarity:154/363 (42%) Gaps:86/363 (24%)


  Fly    29 LDCDGGSDDAWALLL-LLHAAKSHGIHLLAITTMGC-GNTSRENAARNMRRILDAC-KRTDIPIY 90
            ||||.|.|||.|:|| ..|.|    .:||.|:|  | ||...||...|.|.:|.|. |...||:|
Yeast    10 LDCDPGHDDAIAILLGCFHPA----FNLLGIST--CFGNAPPENTDYNARSLLTAMGKAQAIPVY 68

  Fly    91 LGAVDALIPSLEDEKKY---FHGRDGFGDCLTDDCALQLEDIVQA---EHAVTAIHDLCRSRPKQ 149
            .||.    ...:.|..|   .||..|.     |..:|..:...:|   :..:.||.:...:...:
Yeast    69 KGAQ----RPWKREPHYAPDIHGISGL-----DGTSLLPKPTFEARTDKTYIEAIEEAILANNGE 124

  Fly   150 ITIFAVGPLTNLALGYTMY--GPEFGNNFRDLFIMGGNYQGVG--NSSRSAEFNFHSDPEAAHTV 210
            |:..:.|.||.||   |::  .|....:.:.:.||||...|:|  |.:.|||||...||:||:.:
Yeast   125 ISFVSTGALTTLA---TVFRCKPYLKKSVKYISIMGGGLHGLGNCNPNLSAEFNVWIDPDAANYI 186

  Fly   211 L----LRTRC---PITILPWEACLPERFNIHI-----NWRLKD--------FAARAK-----EAG 250
            .    ::.:|   |:. |..:|....:.|..|     |.:|::        ||...|     |:|
Yeast   187 FRDPDVKDKCIVVPLN-LTHKAIATYKVNEMIYNEKNNSKLRELFLELFQFFAHTYKDMQGFESG 250

  Fly   251 HPAITMLNQVEAAQWLPMIEQYGIDTWNPCDAIAVAVWLFEDHLIRRHNTWHATVDLRGTHTRGQ 315
            .|.      .:....:|::|.||   |:|..|:.          .|......:.:|.......|:
Yeast   251 PPI------HDPVALMPLLEFYG---WDPSSAVG----------FRYKRMDISCIDDVFNENSGK 296

  Fly   316 MVLDHLREREKYPENVRIIELVDVE-----FFKRICE 347
            ::::     ::||.:..:..::.::     |:.:|.|
Yeast   297 IIIE-----KEYPNDSDVGTIIGLDLNIQYFWDQIFE 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12177NP_001285222.1 nuc_hydro_CeIAG 25..347 CDD:239115 94/361 (26%)
URH1NP_010688.4 nuc_hydro_IU_UC_XIUA 7..330 CDD:239117 95/363 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1957
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I1713
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002062
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127001
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R16688
TreeFam 1 0.960
76.840

Return to query results.
Submit another query.