DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12177 and LOC548390

Sequence 1:NP_001285222.1 Gene:CG12177 FlyBaseID:FBgn0030510 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001107686.1 Gene:LOC548390 XenbaseID:XB-GENE-5872373 Length:322 Species:Xenopus tropicalis

Alignment Length:349 Identity:116/350 (33%)
Similarity:163/350 (47%) Gaps:68/350 (19%)


  Fly    28 ILDCDGGSDDAWALLLLLHAAKSHGIHLLAITTMGCGNTSRENAARNMRRILDACKRTDIPIYLG 92
            ::|.|.|:|||.|:::.:  |..| :.:|.||.:| |||:.:|..:|:.|:|..|.|:|||::.|
 Frog     9 LIDVDCGTDDAQAIMMAV--AAPH-VEILGITCVG-GNTAVDNVCKNVLRVLRVCNRSDIPVFRG 69

  Fly    93 AVDALIPSLED--EKKYFHGRDGFGDCLTDDCALQLEDIVQAEHAVTAIHDLCRSRPKQITIFAV 155
            |..   |.|.:  ...||||.||.|| :.|..|..:|.| |.||||.|::.:....|.||::.|.
 Frog    70 AFK---PVLGEAIHASYFHGVDGLGD-VPDQDAPDMEQI-QKEHAVDALNRIVSEHPGQISLVAT 129

  Fly   156 GPLTNLALGYTMYGPEFGNNFRDLFIMGGNYQGVGNSSRSAEFNFHSDPEAAHTVLLRTRCPITI 220
            ||||||||...| .|.|....:.|:|||||.:..||::...||||.:|||.|:.||....|...|
 Frog   130 GPLTNLALAVRM-DPTFPQKLKSLYIMGGNMESRGNTTACGEFNFLADPEGAYIVLNEFTCLTYI 193

  Fly   221 LPWE-ACLPERFNIHINW--------------------------RLKDFAARAKEAGHPAITMLN 258
            ..|| ||   |..:...|                          |..:...:|..||...::..:
 Frog   194 ATWEHAC---RHKLSWEWYEQWVNRSTKKADFIKKIYAHSLQYSRYNEKEVKAVVAGPGFVSCDS 255

  Fly   259 QVEAAQWLPMIEQYGIDTWNPCDAIAVAVWLFEDHLIRRHNTWHATVDLRGTHTRGQMVLDHLRE 323
            ...||         .||.....|.|..||                ||:|.|...||.||||.:.:
 Frog   256 YAMAA---------AIDETTVTDFIECAV----------------TVELSGKFARGMMVLDLIGD 295

  Fly   324 REKYPENVRIIELVDVEFFKRICE 347
            .:| ....|::...|:|.|..:.|
 Frog   296 LKK-KSKARVMTGCDMEKFVVLME 318

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12177NP_001285222.1 nuc_hydro_CeIAG 25..347 CDD:239115 115/348 (33%)
LOC548390NP_001107686.1 nuc_hydro_CeIAG 6..318 CDD:239115 115/348 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C108433807
eggNOG 1 0.900 E1_COG1957
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H70970
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D422700at33208
OrthoFinder 1 1.000 FOG0002062
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.710

Return to query results.
Submit another query.