DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12177 and si:dkey-4e7.3

Sequence 1:NP_001285222.1 Gene:CG12177 FlyBaseID:FBgn0030510 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_005167497.1 Gene:si:dkey-4e7.3 ZFINID:ZDB-GENE-070912-542 Length:388 Species:Danio rerio

Alignment Length:348 Identity:111/349 (32%)
Similarity:164/349 (47%) Gaps:61/349 (17%)


  Fly    23 SPRYAILDCDGGSDDAWALLLLLHAAKSHGIHLLAITTMGCGNTSRENAARNMRRILDACKRTDI 87
            |.:...:|.|.|.|||.|:::.|...   |:.:|.|:.:. ||||.||..:|:.|||..||..:|
Zfish    71 SMKKLFVDVDCGVDDAQAIMMALAVP---GVQILGISCVH-GNTSVENVCKNVLRILKVCKHLEI 131

  Fly    88 PIYLGAVDALIPSLEDEKKYFHGRDGFGDCLTDDCALQLEDIVQAEHAVTAIHDLCRSRPKQITI 152
            |::.||...|:..:..... |||:||.||. .|..|..| |:||.|.||:|:..:....|.::::
Zfish   132 PVFRGANKPLLGQVVGTGD-FHGKDGLGDA-PDPEAPGL-DLVQKEGAVSAMIRIVNENPGEVSL 193

  Fly   153 FAVGPLTNLALGYTMYGPEFGNNFRDLFIMGGNYQGVGNSSRSAEFNFHSDPEAAHTVLLRTRCP 217
            .|..||||:||...: .|......:.|:|||||....||::...||||.:|||||:.||....||
Zfish   194 VATAPLTNVALAVKL-DPSLPQKLKGLYIMGGNTDSRGNTTMCGEFNFAADPEAAYIVLNEFTCP 257

  Fly   218 ITI----------LPWEACLPERFNIHINWRLKDFAARAKEAGHPAITMLNQVEAAQWLPMIEQY 272
            :.|          ||||.|        ..|..:|                  .:.|:::..|.|:
Zfish   258 VYIAAWEFTCHSKLPWEFC--------DGWLAQD------------------TDKARFMKQIFQH 296

  Fly   273 GIDT---------------WNPCDAIAVAVWLFEDHLIRRHNTWHATVDLRGTHTRGQMVLDHLR 322
            .:..               :..||:.|:|. ..:|.:|........||:|.|...||.||:|||.
Zfish   297 SMKNSYSERIEKELVAGQGFISCDSYAIAA-AIDDTIILESLERAVTVELAGNCCRGMMVVDHLD 360

  Fly   323 EREKYPENVRIIELVDVEFFKRI 345
            ..:| .....|::.||:|.||.:
Zfish   361 LLQK-THKAHILKKVDLERFKEL 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12177NP_001285222.1 nuc_hydro_CeIAG 25..347 CDD:239115 110/347 (32%)
si:dkey-4e7.3XP_005167497.1 nuc_hydro_CeIAG 73..384 CDD:239115 110/347 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C108433954
eggNOG 1 0.900 E1_COG1957
Hieranoid 1 1.000
Homologene 1 1.000 H70970
Inparanoid 1 1.050 155 1.000 Inparanoid score I4200
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D422700at33208
OrthoFinder 1 1.000 FOG0002062
OrthoInspector 1 1.000 T128758
orthoMCL 1 0.900 OOG5_127001
Panther 1 1.100 O PTHR46190
Phylome 1 0.910 0.811 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.760

Return to query results.
Submit another query.