DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAlig4 and DNL4

DIOPT Version :8

Sequence 1:NP_572907.1 Gene:DNAlig4 / 32322 FlyBaseID:FBgn0030506 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_014647.1 Gene:DNL4 / 854166 SGDID:S000005531 Length:944 Species:Saccharomyces cerevisiae

Alignment Length:1039 Identity:247/1040 (24%)
Similarity:408/1040 (39%) Gaps:237/1040 (23%)


  Fly     4 DIASTIKFRDIC-SLFEKIKATQ----KVANKEEVLKSYYESFCRHRESFRRQTGLNNDQPEDGA 63
            :.|.:..|:.:| .||.||...|    ....|....| |||......|.:|:..|.|        
Yeast    13 NFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFK-YYEIISNFVEMWRKTVGNN-------- 68

  Fly    64 SSFYSVLRLLLPGADTGRDTYGLQITALGRLYIRVLQLPTDSSDAIRLQH------RNGNMYRDY 122
              .|..|.|.||..|  |..|.::...|.|.....|:||.:|:...||:.      :.||:    
Yeast    69 --IYPALVLALPYRD--RRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNL---- 125

  Fly   123 GDVVYSVLKPRCFNPPSN-LRLKEIHQMLDTIANE--------DTEVKQQQLIRFTEQASPEEQK 178
            ..::...:..|...|.|. :.:..::..||:::.:        .:.||.:..:...|..|..|.|
Yeast   126 SSLLVEEIAKRRAEPSSKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHCVENMSFVELK 190

  Fly   179 WLIRLLLKSLGLGIGEQKIFGVLHPKAQDIYQRCSDLGHVCNLLADRTTDLDASSSKDSKAAVKF 243
            :...::||:..:|..|.|:....||.|||.....|||..|.:.|.|....|     ||...::|.
Yeast   191 YFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRL-----KDDDLSIKV 250

  Fly   244 -----------VNLN--SVIRPFHQIRPMLCERFPGDIQELMQSDVLYLETKMDGERFQLH-IDR 294
                       |||:  .:.|..|                    |...:|.||||||.|:| ::.
Yeast   251 GFAFAPQLAKKVNLSYEKICRTLH--------------------DDFLVEEKMDGERIQVHYMNY 295

  Fly   295 GR-FMYISRNGVDYTRNFGHSYDHGTLTPKLRGLLPLGLESIILDGEMMVWDTNK---LRF-REK 354
            |. ..:.||.|:|||..:|.|...||::..||  ....::..:|||||:.:|..:   |.| ..|
Yeast   296 GESIKFFSRRGIDYTYLYGASLSSGTISQHLR--FTDSVKECVLDGEMVTFDAKRRVILPFGLVK 358

  Fly   355 GENTDVKSLKPEGS--WQPCFVVYDLLYFNGQSLLDHTYIQRAYKLQKLIVEQSGVLQLMRARKI 417
            |...:..|.....:  :.|.::|:||||.||.||......||...|..::.....:::::|:.:.
Yeast   359 GSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRC 423

  Fly   418 GSVQEFNELFQQALDSHAEGIVLKKQGSRYQPGVRLGGGWYKDKADYIKGLITEFDVLIIGAFYN 482
            ..|:...:..:.|:...:||:|||...|.|....| ...|.|.|.:|::......|:::||....
Yeast   424 YGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASR-NNNWIKVKPEYLEEFGENLDLIVIGRDSG 487

  Fly   483 RKRTFVDSFLLGVL----------------------QPAPPGSSNR--PEVFSIGVVANNTKQRG 523
            :|    |||:||:|                      |.....:|.|  .::.|...:||...|..
Yeast   488 KK----DSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANGISQEE 548

  Fly   524 V--LNHTLKPHWHDVVNEPPP---LWFHYKPKERSGCPDLWIEPQNSVILQVKAADLAPNGA--- 580
            .  ::...:.||.......||   |.|..|      .|..||:|..|::|::|:..|.....   
Yeast   549 FKEIDRKTRGHWKRTSEVAPPASILEFGSK------IPAEWIDPSESIVLEIKSRSLDNTETNMQ 607

  Fly   581 -FFTRKSLHFPRTEMKRDDKTWSECMTLKEFNDLCGGPLAIKKLNKRQLRLEDVTTKRKQMRMTP 644
             :.|..:|:....:..|.||.|::|.||   |||                     .:.:.::..|
Yeast   608 KYATNCTLYGGYCKRIRYDKEWTDCYTL---NDL---------------------YESRTVKSNP 648

  Fly   645 S---ERSRLGLAVYEKRYDASTSAS---------TSKLFDGLSFCILS-----GSAGRHSKHQLQ 692
            |   |||:||| :.:||.....|.|         .|.:|.||.|.:||     .:..|.::.:|:
Yeast   649 SYQAERSQLGL-IRKKRKRVLISDSFHQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELE 712

  Fly   693 ELAVKNGGCIVENPL-----PNDPKCFCIAGDETFLVKRLILQQPRTCDIVRMEWLLR-VCQKQE 751
            :..|::||.::.|.:     ..|.:  .|:...|...|.||   .|..||:...|:|. :..|:.
Yeast   713 KTIVEHGGKLIYNVILKRHSIGDVR--LISCKTTTECKALI---DRGYDILHPNWVLDCIAYKRL 772

  Fly   752 LELKPRDLIAATEPLQQDLAECFDRHGDSYTKDIANVEELQDLLQGIELTADNVAGITASNLNAL 816
            :.::|......::.::....:..|..|||:..||:.. :|..|.:         :.::...:..|
Yeast   773 ILIEPNYCFNVSQKMRAVAEKRVDCLGDSFENDISET-KLSSLYK---------SQLSLPPMGEL 827

  Fly   817 EDQLLDGK-KNLNMFRNLNAFFYSPH-----GDEVAKLLFLQNGGRIVDD-----------SDPQ 864
            |   :|.: :...:|...|...|.|.     .|::.::.....||:|.|.           :||.
Yeast   828 E---IDSEVRRFPLFLFSNRIAYVPRRKISTEDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPI 889

  Fly   865 LNLGFICMSSDIDNDHFEHWLHNHSKLTTD-----------KVLNSAWIHQCHREGILLPMHSF 917
            |...  ||:            ..|.|:...           :|:...|:.....|...:|...|
Yeast   890 LRKD--CMN------------EVHEKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDF 939

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig4NP_572907.1 DNA_ligase_A_N 10..197 CDD:282522 50/207 (24%)
dnl1 84..613 CDD:273147 152/598 (25%)
Adenylation_DNA_ligase_IV 249..466 CDD:185713 64/225 (28%)
OBF_DNA_ligase_IV 469..607 CDD:153437 40/171 (23%)
BRCT 668..745 CDD:214602 24/87 (28%)
DNL4NP_014647.1 DNA_ligase_A_N 20..207 CDD:282522 49/204 (24%)
dnl1 84..717 CDD:273147 175/700 (25%)
Adenylation_DNA_ligase_IV 244..471 CDD:185713 68/250 (27%)
OBF_DNA_ligase_IV 474..635 CDD:153437 40/171 (23%)
BRCT 681..767 CDD:278934 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C311547747
eggNOG 1 0.900 E1_COG1793
Hieranoid 1 1.000
Homologene 1 1.000 H1736
Inparanoid 1 1.050 167 1.000 Inparanoid score I1014
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003254
OrthoInspector 1 1.000 T1136799
orthoMCL 1 0.900 OOG5_130132
Panther 1 1.100 LDO PTHR45997
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R326
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.