DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ndc80 and NDC80

DIOPT Version :8

Sequence 1:NP_572902.1 Gene:Ndc80 / 32316 FlyBaseID:FBgn0030500 Length:675 Species:Drosophila melanogaster
Sequence 2:NP_012122.3 Gene:NDC80 / 854662 SGDID:S000001406 Length:691 Species:Saccharomyces cerevisiae

Alignment Length:725 Identity:144/726 (20%)
Similarity:283/726 (39%) Gaps:139/726 (19%)


  Fly     1 MSHLMPRR-TSEF---RGDVLEERGTADKRQTRATKRSAATHTPS----------------SSQA 45
            :.|:.|.| ||:.   ....|..|.:.::..|....:|.|.:|.|                |:.|
Yeast    12 LHHMDPHRFTSQIPTATSSQLRRRNSTNQGLTDMINKSIARNTISGTGIPTGGINKNKRTRSTVA 76

  Fly    46 APRRPSASRLPQPLN----LERDRASQMGVTPKRGHRFVPSTAERAIAPHSDKKWVAERAQQILE 106
            .....:|..|....|    :.|...:|:|...:.       .:.|...|..||.:.:...::|.:
Yeast    77 GGTNGTALALNDKSNSRNSVSRLSINQLGSLQQH-------LSNRDPRPLRDKNFQSAIQEEIYD 134

  Fly   107 YLHGIQNSEAPTGLIADLFSRPGGLRHMTIKQFVSILNFMFHHIWRNRVTVGQNHVE----DITS 167
            ||...:........|:..|     |:..|.|.|:.|..:::     .|:..|....:    :|..
Yeast   135 YLKKNKFDIETNHPISIKF-----LKQPTQKGFIIIFKWLY-----LRLDPGYGFTKSIENEIYQ 189

  Fly   168 AMQKLQYPY--QVNKSWL--VSPTTQHSF-G--HVIVLLDFLMDFLPPLPSSDVVEEEFPFMETM 225
            .::.|:||:  .:|||.:  |..:..|.| |  |.:|..:..:|.........::.:....:..:
Yeast   190 ILKNLRYPFLESINKSQISAVGGSNWHKFLGMLHWMVRTNIKLDMCLNKVDRSLINQNTQEITIL 254

  Fly   226 EQPSSYLNSMHCESTTIMSTTQAHAIQLDEDVNGLLFEEASKCIALWDQ-ELTNEEAKLQAETRD 289
            .||...|:...       ...:.:.:.:::.:.....|.....:.|.|. |.:.:|.||..|...
Yeast   255 SQPLKTLDEQD-------QRQERYELMVEKLLIDYFTESYKSFLKLEDNYEPSMQELKLGFEKFV 312

  Fly   290 QVISKKCDLPDRKALDQLIGDLKTKLQQLENKLHDPSEDNKL-----NKLERLTKEHDQLAQQLA 349
            .:|:  .|:.:.:..:..:.:...::.::..|:....|..|.     ||.|.......|.:|:..
Yeast   313 HIIN--TDIANLQTQNDNLYEKYQEVMKISQKIKTTREKWKALKSDSNKYENYVNAMKQKSQEWP 375

  Fly   350 ASEEELIKKLKLYEQLSAQVEEKQSNLRQQMKYEKRLEQAVNRQKFSAQQLKELQMKCDDMENYS 414
            ...|::..:.:|.|:   :::..|||:.:       |.:.:.::..|.:|. |||         :
Yeast   376 GKLEKMKSECELKEE---EIKALQSNISE-------LHKILRKKGISTEQF-ELQ---------N 420

  Fly   415 KAYERQVKEVSELELHQQVMLSRAKQKQLDSVEVFNSHVRHL-SMDPVICGLIKSGIGQQSDLTL 478
            :..|:..:|:.::.:....:.|..|.::|::..:|.|.:..| ..|..|..|.:|        ..
Yeast   421 QEREKLTRELDKINIQSDKLTSSIKSRKLEAEGIFKSLLDTLRQYDSSIQNLTRS--------RS 477

  Fly   479 PLNPNQEDISERVQCLELLGKLLQQHRQQNIDRRQMLDKQVA---KVKSDSIELDTEIATMDSQL 540
            .|..|..|.|.::...|   .||.:...:.|...|:..|...   .:|...::|:.||       
Yeast   478 QLGHNVNDSSLKINISE---NLLDRDFHEGISYEQLFPKGSGINESIKKSILKLNDEI------- 532

  Fly   541 RAQKQRLTKMEASYRT-KRDMQAQHRQQLLEDQYDQTARLDELEKREKQALEKLEASKQRNEDLL 604
               ::|:..:|....| ::|:     :.|..|..::|...::||....:|..|.|.|||.||.||
Yeast   533 ---QERIKTIEKDNITLEKDI-----KNLKHDINEKTQINEKLELELSEANSKFELSKQENERLL 589

  Fly   605 TAAEQFQEQDLKARQDRLEKCEQKLAKAEDQLLAVESK-------VNATQAKLNEVEQKVYSAKL 662
            .           |::..:||.|:|:   .|..|.:::|       |.:|:.||.|::..:...:.
Yeast   590 V-----------AQRIEIEKMEKKI---NDSNLLMKTKISDAEELVTSTELKLEELKVDLNRKRY 640

  Fly   663 PSFQPVLDAI 672
            ...|.|:..|
Yeast   641 KLHQQVIHVI 650

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ndc80NP_572902.1 Ndc80_HEC 63..204 CDD:281754 32/152 (21%)
NDC80NP_012122.3 HEC1 1..683 CDD:227512 144/726 (20%)
Ndc80_HEC 91..246 CDD:281754 34/172 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5185
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003250
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.