DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ndc80 and Ndc80

DIOPT Version :8

Sequence 1:NP_572902.1 Gene:Ndc80 / 32316 FlyBaseID:FBgn0030500 Length:675 Species:Drosophila melanogaster
Sequence 2:NP_075783.2 Gene:Ndc80 / 67052 MGIID:1914302 Length:642 Species:Mus musculus

Alignment Length:701 Identity:142/702 (20%)
Similarity:283/702 (40%) Gaps:166/702 (24%)


  Fly    17 LEERGTAD---------KRQTRATKRSAATHTPSSSQAAP---RRPSASRLPQPLNLERDRASQM 69
            ::|..|.|         :.:.|:|....:||.|:|.:...   :|.|.         ...|.||:
Mouse    16 MQELRTLDLNKPGLYTPQTKERSTFGKLSTHKPTSERKVSIFGKRTSG---------HGSRNSQL 71

  Fly    70 GVTPKRGHRFVPSTAERAIAPHSDKKWVAERAQQILEYLHGIQNSEAPTGLIADLFSRPGGLRHM 134
            |:       |..|...:...|.:||.::.:..:|:.|:|       ...|.:..:..:  .|:..
Mouse    72 GI-------FSSSEKIKDPRPLNDKAFIQQCIRQLYEFL-------TENGYVYSVSMK--SLQAP 120

  Fly   135 TIKQFVSILNFMFHHIWRNRVTVGQNHVEDITSAMQKLQYPYQVNKSWLVSPTTQHSFGHVIVLL 199
            :.|:|:.|..|::..:..:....|....|::....:.|.||:.::||.:.:....|::.|::..|
Mouse   121 STKEFLKIFAFLYGFLCPSYELPGTKCEEEVPRIFKALGYPFTLSKSSMYTVGAPHTWPHIVAAL 185

  Fly   200 DFLMDFLPPLPSSDVVEEEFPFMETMEQPSSYLNSMHCESTTIMSTTQAHAIQLDEDV--NGLLF 262
            .:|:|.:.                        :::...||:.:....|....:.::.:  |.|..
Mouse   186 VWLIDCIK------------------------IDTAMKESSPLFDDGQLWGEETEDGIKHNKLFL 226

  Fly   263 EEASKCIALWDQELT------NEEAKLQAETRD--QVISKKCDL--PDRKALDQLIGDLKTKLQQ 317
            |...||   :::.:|      .|:|:|||:.:|  :|.:.|.:.  .:.|||::.|..|:.:.::
Mouse   227 EYTKKC---YEKFMTGADSFEEEDAELQAKLKDLYKVDASKLESLEAENKALNEQIARLEEERER 288

  Fly   318 LENKLHDPSEDNKLNKLERLTKEHDQLAQQLAASEEELIKKLKLYEQLSAQVEEKQSNLRQQMKY 382
                     |.|:|..|::|........|...|....|...|.:.:|.|..::|:...:.|:.:.
Mouse   289 ---------EPNRLMSLKKLKASLQADVQNYKAYMSNLESHLAVLKQKSNSLDEEIGRVEQECET 344

  Fly   383 EK----RLEQAVNRQKFSAQQLKELQMKCDDMENYSKAYERQV--KEVSELELHQQVM----LSR 437
            .|    ||:..|:.||:|...::.:        |:.|...:|.  |...:||..||.|    |..
Mouse   345 VKQENTRLQSIVDNQKYSVADIERI--------NHEKNELQQTINKLTKDLEAEQQQMWNEELKY 401

  Fly   438 AKQKQLDSVEVFNSH--VRHLSMDPVICGLIKSGIGQQS-DLTLPLNPNQED---ISERVQCLEL 496
            |:.|:....::...|  .|.|.:.|      |.....:. |..:..||....   :..|.|....
Mouse   402 ARGKEAIEAQLAEYHKLARKLKLIP------KGAENSKGYDFEIKFNPEAGANCLVKYRTQVYAP 460

  Fly   497 LGKLLQQHRQQNIDRRQMLDKQVAKVK--SDSIELDTEIATMDSQLRAQKQRLTKMEASYRTKRD 559
            |.:||.:..::       ::|.:.|.:  .|::|   ::.||.::.: ...|:.|.|.       
Mouse   461 LKELLNESEEE-------INKALNKKRHLEDTLE---QLNTMKTESK-NTVRMLKEEI------- 507

  Fly   560 MQAQHRQQLLEDQYDQTARLDELEKREKQALEKLEASKQRNEDLLTAAEQFQEQDLKARQDRLEK 624
                   |.|:|.:.|..:  |.|:::|::..:|| |.::::.||.:.                 
Mouse   508 -------QKLDDLHQQAVK--EAEEKDKKSASELE-SLEKHKHLLESG----------------- 545

  Fly   625 CEQKLAKAEDQLLAVESKVNATQAKLNEVEQKVYSAKLPSFQPVLDAIKNH 675
            ....|::|.|:|.||:.:...|.....|..:||.:    :.|.:|:.:..|
Mouse   546 VNDGLSEAMDELDAVQREYQLTVKTTTEERRKVEN----NLQRLLEMVATH 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ndc80NP_572902.1 Ndc80_HEC 63..204 CDD:281754 29/141 (21%)
Ndc80NP_075783.2 Interaction with the N-terminus of CDCA1. {ECO:0000250} 1..445 95/463 (21%)
Nuclear localization. {ECO:0000250} 1..250 44/246 (18%)
HEC1 48..619 CDD:227512 120/601 (20%)
Ndc80_HEC 51..205 CDD:281754 30/154 (19%)
Interaction with RB1. {ECO:0000250} 128..251 20/123 (16%)
Interaction with NEK2 and ZWINT. {ECO:0000250} 251..618 85/397 (21%)
Interaction with SMC1A. {ECO:0000250} 251..431 46/198 (23%)
DUF342 <324..394 CDD:302792 19/74 (26%)
Interaction with PSMC2 and SMC1A. {ECO:0000250} 361..547 43/204 (21%)
Interaction with the C-terminus of CDCA1 and the SPBC24-SPBC25 subcomplex. {ECO:0000250} 446..642 40/204 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5185
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5213
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003250
OrthoInspector 1 1.000 T1085256
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.