DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ndc80 and NDC80

DIOPT Version :8

Sequence 1:NP_572902.1 Gene:Ndc80 / 32316 FlyBaseID:FBgn0030500 Length:675 Species:Drosophila melanogaster
Sequence 2:NP_006092.1 Gene:NDC80 / 10403 HGNCID:16909 Length:642 Species:Homo sapiens

Alignment Length:712 Identity:139/713 (19%)
Similarity:283/713 (40%) Gaps:184/713 (26%)


  Fly    11 EFRGDVLEERGTADKRQTRATKRSAATHTPSSSQAAPRRPSASR----LPQPLNLERDRASQMGV 71
            |.|...:.::|.    .|..||..     |:..:.:..:|::.|    ..:..:....|.||:|:
Human    18 ELRSQDVNKQGL----YTPQTKEK-----PTFGKLSINKPTSERKVSLFGKRTSGHGSRNSQLGI 73

  Fly    72 TPKRGHRFVPSTAERAIAPHSDKKWVAERAQQILEYL------HGI--QNSEAPTGLIADLFSRP 128
                   |..|...:...|.:||.::.:..:|:.|:|      |.:  ::.:||           
Human    74 -------FSSSEKIKDPRPLNDKAFIQQCIRQLCEFLTENGYAHNVSMKSLQAP----------- 120

  Fly   129 GGLRHMTIKQFVSILNFMFHHIWRNRVTVGQNHVEDITSAMQKLQYPYQVNKSWLVSPTTQHSFG 193
                  ::|.|:.|..|::..:..:.........|::....:.|.||:.::||.:.:....|::.
Human   121 ------SVKDFLKIFTFLYGFLCPSYELPDTKFEEEVPRIFKDLGYPFALSKSSMYTVGAPHTWP 179

  Fly   194 HVIVLLDFLMDFL----PPLPSSDVVEEEFPFMETMEQPSSYLNSMHCESTTIMSTTQAHAIQLD 254
            |::..|.:|:|.:    ....||.:.::..|:.|..|.     ..||                  
Human   180 HIVAALVWLIDCIKIHTAMKESSPLFDDGQPWGEETED-----GIMH------------------ 221

  Fly   255 EDVNGLLFEEASKCIALWDQELTNEE------AKLQAETRDQVISKKCDLPDRKALDQLIGDLKT 313
               |.|..:...||   ::..::..:      |:||::.:|........|...:|.::.:.:...
Human   222 ---NKLFLDYTIKC---YESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIA 280

  Fly   314 KLQQLENKLHDPSEDNKLNKLERLTKEHDQLAQQLAASEEELIKKLKLY----EQLSAQVEEKQS 374
            :|:|...|  :|      |:||.|.|        |.||.:..::|.:.|    |..||.:::|.:
Human   281 RLEQEREK--EP------NRLESLRK--------LKASLQGDVQKYQAYMSNLESHSAILDQKLN 329

  Fly   375 NLRQQ----------MKYEK-RLEQAVNRQKFSAQQLKELQMKCDDMENYSKAYERQVKEVSELE 428
            .|.::          :|.|. ||:..::.||:|...::.:..:.::::....      |...:||
Human   330 GLNEEIARVELECETIKQENTRLQNIIDNQKYSVADIERINHERNELQQTIN------KLTKDLE 388

  Fly   429 LHQQVM----LSRAKQKQLDSVEVFNSH--VRHLSMDPVICGLIKSGIGQQS-DLTLPLNPNQED 486
            ..||.:    |..|:.|:....::...|  .|.|.:.|      |.....:. |..:..||....
Human   389 AEQQKLWNEELKYARGKEAIETQLAEYHKLARKLKLIP------KGAENSKGYDFEIKFNPEAGA 447

  Fly   487 ---ISERVQCLELLGKLLQQHRQQNIDRRQMLDKQVAKVKSDSIELDTEIATMDSQLRAQKQRLT 548
               :..|.|....|.:||.: .::.|::  .|:|::.  ..|::|          ||.|.   :|
Human   448 NCLVKYRAQVYVPLKELLNE-TEEEINK--ALNKKMG--LEDTLE----------QLNAM---IT 494

  Fly   549 KMEASYRTKRDMQAQHRQQLLEDQYDQTARLDELEKREKQALEKLEASKQRNEDLLTAAEQFQEQ 613
            :.:.|.||.::     ..|.|:|.|.|  ::.|.|:.:::...:|| |.::::.||.:.      
Human   495 ESKRSVRTLKE-----EVQKLDDLYQQ--KIKEAEEEDEKCASELE-SLEKHKHLLEST------ 545

  Fly   614 DLKARQDRLEKCEQKLAKAEDQLLAVESKVNATQAKLNEVEQKVYSAKLPSFQPVLDAIKNH 675
                       ..|.|::|.::|.||:.:.........|..:||.:    :.|.:|:.:..|
Human   546 -----------VNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGN----NLQRLLEMVATH 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ndc80NP_572902.1 Ndc80_HEC 63..204 CDD:281754 29/149 (19%)
NDC80NP_006092.1 Interaction with the N-terminus of CDCA1 1..445 98/517 (19%)
Nuclear localization 1..250 51/294 (17%)
Ndc80_HEC 51..206 CDD:309070 33/179 (18%)
Interaction with RB1 128..251 26/152 (17%)
SMC_N <238..633 CDD:330553 89/431 (21%)
Interaction with NEK2 and ZWINT. {ECO:0000269|PubMed:16732327} 251..618 87/418 (21%)
Interaction with SMC1A 251..431 43/208 (21%)
Interaction with PSMC2 and SMC1A 361..547 46/241 (19%)
Interaction with the C-terminus of CDCA1 and the SPBC24-SPBC25 subcomplex 446..642 41/195 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5185
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5310
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D364574at33208
OrthoFinder 1 1.000 FOG0003250
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.