DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXD1 and Antp

Sequence 1:NP_078777.1 Gene:HOXD1 HGNCID:5132 Length:328 Species:Homo sapiens
Sequence 2:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster

Alignment Length:244 Identity:70/245 (29%)
Similarity:94/245 (38%) Gaps:81/245 (33%)


Human    82 YAQCTLEGAYEPGAAPAAAAGGADYGFLGSGPAYDFPGVLGRAADDGGSHVHYATSAVFSGGGSF 146
            ||.|.|:          ||.||     ||..|....|.::.:.:   |.|::...:.....|.. 
  Fly   159 YASCKLQ----------AAVGG-----LGMVPEGGSPPLVDQMS---GHHMNAQMTLPHHMGHP- 204

Human   147 LLSGQVDYAAFGEP------------------------------------GPFPACLKASADGHP 175
              ..|:.|...|.|                                    ||     .....|||
  Fly   205 --QAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGP-----PQMHQGHP 262

Human   176 GAFQTASPAPGTYPKSVSPASGLPAAFSTFEWMKVKRNASKKGKLAEYGAASPSSAIRTNFSTKQ 240
            |.....|..|.      |.:||:|:..  :.||:           :::|........|..::..|
  Fly   263 GQHTPPSQNPN------SQSSGMPSPL--YPWMR-----------SQFGKCQERKRGRQTYTRYQ 308

Human   241 LTELEKEFHFNKYLTRARRIEIANCLHLNDTQVKIWFQNRRMKQKKRER 289
            ..|||||||||:||||.||||||:.|.|.:.|:||||||||||.||..:
  Fly   309 TLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENK 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXD1NP_078777.1 Antp-type hexapeptide 204..209 2/5 (40%)
Homeobox 233..285 CDD:278475 34/52 (65%)
AntpNP_996167.1 Homeobox 301..353 CDD:278475 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.