DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15756 and Cpr65Au

DIOPT Version :10

Sequence 1:NP_572895.1 Gene:CG15756 / 32308 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_652661.1 Gene:Cpr65Au / 59158 FlyBaseID:FBgn0042119 Length:106 Species:Drosophila melanogaster


Alignment Length:59 Identity:20/59 - (33%)
Similarity:29/59 - (49%) Gaps:2/59 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 QYEFRYQLDNGNTRYERAYWLPVG--KDLVLAKKGYYSVPLPNDKYSTVFYTADHRGYH 163
            :|.|.|:..||.:|.|.....|..  :|..|:.:|..|...|:.|...:.:|||..|||
  Fly    41 KYSFAYETSNGISRTETGEVKPGAGEEDGSLSVQGSTSWSAPDGKKYEISFTADETGYH 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:459790 17/55 (31%)
Cpr65AuNP_652661.1 Chitin_bind_4 42..98 CDD:459790 17/55 (31%)

Return to query results.
Submit another query.