DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15756 and Cpr49Af

DIOPT Version :10

Sequence 1:NP_572895.1 Gene:CG15756 / 32308 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster


Alignment Length:70 Identity:21/70 - (30%)
Similarity:30/70 - (42%) Gaps:4/70 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 DSFDQRS---LDGQYEFRYQLDNGNTRYERAYWLPVGKD-LVLAKKGYYSVPLPNDKYSTVFYTA 157
            |...|.|   .:|:|.:.|:|.:|:...:......|..| ...:..|.||....:.|...|.|||
  Fly    21 DPISQESNVEYNGKYHYHYELKDGSKATQDGVLKSVNADHNGESVNGKYSFVADDGKTYVVSYTA 85

  Fly   158 DHRGY 162
            |..||
  Fly    86 DENGY 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:459790 15/54 (28%)
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790 15/54 (28%)

Return to query results.
Submit another query.