powered by:
Protein Alignment CG15756 and Cpr49Af
DIOPT Version :9
| Sequence 1: | NP_572895.1 |
Gene: | CG15756 / 32308 |
FlyBaseID: | FBgn0030493 |
Length: | 298 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001286347.1 |
Gene: | Cpr49Af / 36352 |
FlyBaseID: | FBgn0033729 |
Length: | 126 |
Species: | Drosophila melanogaster |
| Alignment Length: | 70 |
Identity: | 21/70 - (30%) |
| Similarity: | 30/70 - (42%) |
Gaps: | 4/70 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 97 DSFDQRS---LDGQYEFRYQLDNGNTRYERAYWLPVGKD-LVLAKKGYYSVPLPNDKYSTVFYTA 157
|...|.| .:|:|.:.|:|.:|:...:......|..| ...:..|.||....:.|...|.|||
Fly 21 DPISQESNVEYNGKYHYHYELKDGSKATQDGVLKSVNADHNGESVNGKYSFVADDGKTYVVSYTA 85
Fly 158 DHRGY 162
|..||
Fly 86 DENGY 90
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.