DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15756 and Cpr49Af

Sequence 1:NP_572895.1 Gene:CG15756 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001286347.1 Gene:Cpr49Af FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster

Alignment Length:70 Identity:21/71 (30%)
Similarity:30/71 (42%) Gaps:4/71 (6%)


  Fly    97 DSFDQRS---LDGQYEFRYQLDNGNTRYERAYWLPVGKD-LVLAKKGYYSVPLPNDKYSTVFYTA 157
            |...|.|   .:|:|.:.|:|.:|:...:......|..| ...:..|.||....:.|...|.|||
  Fly    21 DPISQESNVEYNGKYHYHYELKDGSKATQDGVLKSVNADHNGESVNGKYSFVADDGKTYVVSYTA 85

  Fly   158 DHRGY 162
            |..||
  Fly    86 DENGY 90

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:278791 16/55 (29%)
Cpr49AfNP_001286347.1 Chitin_bind_4 35..90 CDD:278791 16/55 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.