DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15756 and Lcp1

Sequence 1:NP_572895.1 Gene:CG15756 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_001260801.1 Gene:Lcp1 FlyBaseID:FBgn0002531 Length:130 Species:Drosophila melanogaster

Alignment Length:128 Identity:29/129 (22%)
Similarity:47/129 (36%) Gaps:28/129 (22%)


  Fly   169 LSVEQPLLPRSLEVPGVERDVGSGM----------GMGTGIATGTGTKRNSISDPERNELPVEVE 223
            |:|..|.:|.||   |...||.:.:          |..:.:.|..|.::.:..|...|     :.
  Fly    13 LAVANPPVPHSL---GRSEDVHADVLSQSDDVRADGFDSSLHTSNGIEQAASGDAHGN-----IH 69

  Fly   224 VN------EAEDVDVDVDASDAGTELVPNAVNQVETETEPSTLANDI--LATGAPADSHDDDH 278
            .|      |.|.|:|...|::.|.:  |:..........|..:|..:  |.:..||..|...|
  Fly    70 GNFGWISPEGEHVEVKYVANENGYQ--PSGAWIPTPPPIPEAIARAVAWLESHPPAPEHPRHH 130

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:278791
Lcp1NP_001260801.1 Chitin_bind_4 46..93 CDD:278791 11/52 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.